| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336079.1 | 5prime_partial | 181 | 640-95(-) |
Amino Acid sequence : | |||
| DLFLLTESSKSAIMLVYQDLISGDELLSDFFPYKEIENGCLWEVEGKWVVKGSVDVDIGANPSAEGGEDDEGVDVQAVKVVDIVDTFRLQEQPPFDKKQFIGYMKKYIKTLSGKLEGEQL DQFKKGMEGATKFLLGKIKDLQFFVGESMTDDSSLVFAYYKDGATDPTFLYLAHGLKEIKC* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 20,265.819 | ||
| Theoretical pI: | 4.491 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
| Instability index: | 23.608 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.219 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.193 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336079.1 | 5prime_partial | 181 | 640-95(-) |
Amino Acid sequence : | |||
| DLFLLTESSKSAIMLVYQDLISGDELLSDFFPYKEIENGCLWEVEGKWVVKGSVDVDIGANPSAEGGEDDEGVDVQAVKVVDIVDTFRLQEQPPFDKKQFIGYMKKYIKTLSGKLEGEQL DQFKKGMEGATKFLLGKIKDLQFFVGESMTDDSSLVFAYYKDGATDPTFLYLAHGLKEIKC* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 20,265.819 | ||
| Theoretical pI: | 4.491 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
| Instability index: | 23.608 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.219 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.193 | ||
| sheet | 0.254 | ||