Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336089.1 | 5prime_partial | 138 | 654-238(-) |
Amino Acid sequence : | |||
SNPFLVKGKCYCDTCRCGFETPATKYFGGFKVKVECKNRGANKIPYPIDGVTNSQGEFNILVKRDCGDDVCDVVLVGSGDKSCNKPQAGCDRARVAFPRNNGKTFDVRFANNMGFLSKEP FAACNEILQQFQLTEDQY* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 11,088.845 | ||
Theoretical pI: | 11.041 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 59.159 | ||
aromaticity | 0.049 | ||
GRAVY | -0.103 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.314 | ||
sheet | 0.265 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336089.1 | complete | 102 | 317-625(+) |
Amino Acid sequence : | |||
MLLAKRTSKVLPLLRGKATRARSQPAWGLLHDLSPLPTSTTSQTSSPQSRLTKMLNSPCEFVTPSIGYGILLAPLFLHSTLTLNPPKYLVAGVSNPHRQVSQ* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,088.845 | ||
Theoretical pI: | 11.041 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 59.159 | ||
aromaticity | 0.049 | ||
GRAVY | -0.103 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.314 | ||
sheet | 0.265 |