| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336089.1 | 5prime_partial | 138 | 654-238(-) |
Amino Acid sequence : | |||
| SNPFLVKGKCYCDTCRCGFETPATKYFGGFKVKVECKNRGANKIPYPIDGVTNSQGEFNILVKRDCGDDVCDVVLVGSGDKSCNKPQAGCDRARVAFPRNNGKTFDVRFANNMGFLSKEP FAACNEILQQFQLTEDQY* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 11,088.845 | ||
| Theoretical pI: | 11.041 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 59.159 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.103 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.314 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336089.1 | complete | 102 | 317-625(+) |
Amino Acid sequence : | |||
| MLLAKRTSKVLPLLRGKATRARSQPAWGLLHDLSPLPTSTTSQTSSPQSRLTKMLNSPCEFVTPSIGYGILLAPLFLHSTLTLNPPKYLVAGVSNPHRQVSQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,088.845 | ||
| Theoretical pI: | 11.041 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 59.159 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.103 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.314 | ||
| sheet | 0.265 | ||