| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336096.1 | internal | 181 | 1-543(+) |
Amino Acid sequence : | |||
| FQTSRQLHTPCWTRRQFSDMAMASSLPSPLTIKTSLKQPDVKLPGVGPCAARSLPLPSLKLTARPSSSSVPVVVAAATSMVGVETQAGAATPAKVLPFRVGHGFDLHRLEPGYPLIVGGI NIPHDRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDTDPKWNGAPSSVFMEEAVRVM | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 19,123.893 | ||
| Theoretical pI: | 7.166 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 41.871 | ||
| aromaticity | 0.050 | ||
| GRAVY | 0.085 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.287 | ||
| sheet | 0.249 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336096.1 | internal | 181 | 1-543(+) |
Amino Acid sequence : | |||
| FQTSRQLHTPCWTRRQFSDMAMASSLPSPLTIKTSLKQPDVKLPGVGPCAARSLPLPSLKLTARPSSSSVPVVVAAATSMVGVETQAGAATPAKVLPFRVGHGFDLHRLEPGYPLIVGGI NIPHDRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDTDPKWNGAPSSVFMEEAVRVM | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 19,123.893 | ||
| Theoretical pI: | 7.166 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 41.871 | ||
| aromaticity | 0.050 | ||
| GRAVY | 0.085 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.287 | ||
| sheet | 0.249 | ||