| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336098.1 | 3prime_partial | 230 | 38-727(+) |
Amino Acid sequence : | |||
| MALTLSLNTKQSPPIKAISTFRRPPPPCMATAVAVAGNQSYWDTIRDDINSYLKKAIPIRSPETVFEPMHHLTLSAPSTTASALCVAACELIGGHRSQAIAAASAIHLVHAAAHAHEHLP LTDGSRPECKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGAACGAI | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 17,426.669 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 88.851 | ||
| aromaticity | 0.020 | ||
| GRAVY | -1.210 | ||
Secondary Structure Fraction | |||
| Helix | 0.163 | ||
| turn | 0.327 | ||
| sheet | 0.183 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336098.1 | 3prime_partial | 173 | 519-1(-) |
Amino Acid sequence : | |||
| MDRARSSNPNGAIPSPVRSSMLGLNLCWISGLHSGLEPSVRGRCSWAWAAACTRCMAEAAAMAWLRWPPMSSQAATQRAEAVVEGAERVRWCMGSNTVSGDLIGMAFLRYELMSSRMVSQ YDWFPATATAVAMHGGGGRRKVDIALMGGLCLVLRERVRAILIELWRQSYKEC | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 17,426.669 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 88.851 | ||
| aromaticity | 0.020 | ||
| GRAVY | -1.210 | ||
Secondary Structure Fraction | |||
| Helix | 0.163 | ||
| turn | 0.327 | ||
| sheet | 0.183 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336098.1 | 5prime_partial | 153 | 1-462(+) |
Amino Acid sequence : | |||
| ALFITLPPQFNQNGSNSLSQHQTKSPHQSDINLPPSTAAVHGHRRRRRREPIILGHHPGRHQLVSQESHPNKIAGNGIRAHAPPHPLRPLHHRLRPLCGGLRAHRRPPEPSHRRRLRHTP RACGGPRPRAPPPNRRLQARMQARYPTQVQPQH* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 17,426.669 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 88.851 | ||
| aromaticity | 0.020 | ||
| GRAVY | -1.210 | ||
Secondary Structure Fraction | |||
| Helix | 0.163 | ||
| turn | 0.327 | ||
| sheet | 0.183 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336098.1 | 3prime_partial | 230 | 38-727(+) |
Amino Acid sequence : | |||
| MALTLSLNTKQSPPIKAISTFRRPPPPCMATAVAVAGNQSYWDTIRDDINSYLKKAIPIRSPETVFEPMHHLTLSAPSTTASALCVAACELIGGHRSQAIAAASAIHLVHAAAHAHEHLP LTDGSRPECKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGAACGAI | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 17,426.669 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 88.851 | ||
| aromaticity | 0.020 | ||
| GRAVY | -1.210 | ||
Secondary Structure Fraction | |||
| Helix | 0.163 | ||
| turn | 0.327 | ||
| sheet | 0.183 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336098.1 | 3prime_partial | 173 | 519-1(-) |
Amino Acid sequence : | |||
| MDRARSSNPNGAIPSPVRSSMLGLNLCWISGLHSGLEPSVRGRCSWAWAAACTRCMAEAAAMAWLRWPPMSSQAATQRAEAVVEGAERVRWCMGSNTVSGDLIGMAFLRYELMSSRMVSQ YDWFPATATAVAMHGGGGRRKVDIALMGGLCLVLRERVRAILIELWRQSYKEC | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 17,426.669 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 88.851 | ||
| aromaticity | 0.020 | ||
| GRAVY | -1.210 | ||
Secondary Structure Fraction | |||
| Helix | 0.163 | ||
| turn | 0.327 | ||
| sheet | 0.183 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336098.1 | 5prime_partial | 153 | 1-462(+) |
Amino Acid sequence : | |||
| ALFITLPPQFNQNGSNSLSQHQTKSPHQSDINLPPSTAAVHGHRRRRRREPIILGHHPGRHQLVSQESHPNKIAGNGIRAHAPPHPLRPLHHRLRPLCGGLRAHRRPPEPSHRRRLRHTP RACGGPRPRAPPPNRRLQARMQARYPTQVQPQH* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 17,426.669 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 88.851 | ||
| aromaticity | 0.020 | ||
| GRAVY | -1.210 | ||
Secondary Structure Fraction | |||
| Helix | 0.163 | ||
| turn | 0.327 | ||
| sheet | 0.183 | ||