| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336099.1 | 5prime_partial | 205 | 683-66(-) |
Amino Acid sequence : | |||
| AIHLVHAGAHAHEHLPLTDGSRPECKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCG AACGAILAGGADEEIEKLRNFGLCAGTMRALMEVGNTPEIEKIVRRLKDLALKEMEGFPGEKAELMSNLVAERSRAEPLRVEELK* | |||
Physicochemical properties | |||
| Number of amino acids: | 205 | ||
| Molecular weight: | 16,243.151 | ||
| Theoretical pI: | 9.945 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 65.293 | ||
| aromaticity | 0.120 | ||
| GRAVY | -0.082 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.393 | ||
| sheet | 0.180 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336099.1 | 5prime_partial | 150 | 1-453(+) |
Amino Acid sequence : | |||
| QHKTYFSNIHLFNLSVSQHKYIYFNSSTRNGSARLRSATRFDISSAFSPGKPSISLRAKSFNLLTIFSISGVFPTSINALIVPAQSPKFLSFSISSSAPPANMAPQAAPQPCISPYFFRH TYSTNPNLESGSTISASLYSPSISPCEPAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 16,243.151 | ||
| Theoretical pI: | 9.945 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 65.293 | ||
| aromaticity | 0.120 | ||
| GRAVY | -0.082 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.393 | ||
| sheet | 0.180 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336099.1 | 5prime_partial | 205 | 683-66(-) |
Amino Acid sequence : | |||
| AIHLVHAGAHAHEHLPLTDGSRPECKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCG AACGAILAGGADEEIEKLRNFGLCAGTMRALMEVGNTPEIEKIVRRLKDLALKEMEGFPGEKAELMSNLVAERSRAEPLRVEELK* | |||
Physicochemical properties | |||
| Number of amino acids: | 205 | ||
| Molecular weight: | 16,243.151 | ||
| Theoretical pI: | 9.945 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 65.293 | ||
| aromaticity | 0.120 | ||
| GRAVY | -0.082 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.393 | ||
| sheet | 0.180 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336099.1 | 5prime_partial | 150 | 1-453(+) |
Amino Acid sequence : | |||
| QHKTYFSNIHLFNLSVSQHKYIYFNSSTRNGSARLRSATRFDISSAFSPGKPSISLRAKSFNLLTIFSISGVFPTSINALIVPAQSPKFLSFSISSSAPPANMAPQAAPQPCISPYFFRH TYSTNPNLESGSTISASLYSPSISPCEPAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 16,243.151 | ||
| Theoretical pI: | 9.945 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 65.293 | ||
| aromaticity | 0.120 | ||
| GRAVY | -0.082 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.393 | ||
| sheet | 0.180 | ||