| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336127.1 | 5prime_partial | 212 | 1-639(+) |
Amino Acid sequence : | |||
| GSHPLRLVPLLCFSGLSFSPGVASLFVSVLSPSPFVSSFLFSVLSPSPGVSSLFLAFSPVVSSFLFSEFTFSVVSSLVSAPLSFCSVLPSLGLSLLSFSSKLSSLSLPTFSLSPFSSLAF TSFSSPSLLFSTFSPSAEFPSFSPSSAVFSGSCHLSSGLFSASKCTCSSTSSSLGWRSFLPSLILLPLPSSSIFPTTLLVSTMTFLLRECCT* | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 20,509.217 | ||
| Theoretical pI: | 9.736 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11500 | ||
| Instability index: | 59.506 | ||
| aromaticity | 0.161 | ||
| GRAVY | 1.646 | ||
Secondary Structure Fraction | |||
| Helix | 0.572 | ||
| turn | 0.178 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336127.1 | complete | 190 | 578-6(-) |
Amino Acid sequence : | |||
| MEEEGSGSNIKLGRKDLQPKEDEVEEQVHFDAENKPDDKWQDPEKTAEEGENEGNSADGENVENRSDGEEKEVKASEENGESENVGSERDDNLEENESKDNPSEGSTEQNESGAETSEDT TENVNSENKNEETTGENAKKSEETPGEGESTENKNEETNGEGDNTETKSEATPGENESPEKHKRGTNRRG* | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 20,509.217 | ||
| Theoretical pI: | 9.736 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11500 | ||
| Instability index: | 59.506 | ||
| aromaticity | 0.161 | ||
| GRAVY | 1.646 | ||
Secondary Structure Fraction | |||
| Helix | 0.572 | ||
| turn | 0.178 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336127.1 | 5prime_partial | 180 | 3-545(+) |
Amino Acid sequence : | |||
| VSPSPVSSPFMLLGALILSWCRFTLRFSVVTLSICFLILILGALTLSGCFFTFLGVLSRCLFIFVLRVHVLCRILTRFRSTLILLCTSFTWVVFALVLLQVVIPFTTNILTFTILFTCFH FLLFPITPILNIFTISRIPFILTLFCCFLRVLPFIIGLIFGVKMHLFLNLIFFGLEILPP* | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 20,509.217 | ||
| Theoretical pI: | 9.736 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11500 | ||
| Instability index: | 59.506 | ||
| aromaticity | 0.161 | ||
| GRAVY | 1.646 | ||
Secondary Structure Fraction | |||
| Helix | 0.572 | ||
| turn | 0.178 | ||
| sheet | 0.244 | ||