Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336128.1	5prime_partial	143	2-433(+)
Amino Acid sequence :
HPVIMAIDINRDTYRDLDYRSLRRPRVKHKIDFIESKALPALDHLLKDGENKESFDFAFVDADKVNYANYHERVLELLRPGGIVVYDNTLWGGTVAMAPDLVAESKLQYRNAAVEFNNFI AADSRVQISQLPVGDGITVCRRK*
Physicochemical properties
Number of amino acids:		143
Molecular weight:		12,200.249
Theoretical pI:		10.369
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		41480 41480
Instability index:		40.683
aromaticity		0.165
GRAVY		0.234
Secondary Structure Fraction
Helix		0.437
turn		0.214
sheet		0.262

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336128.1	complete	115	481-134(-)
Amino Acid sequence :
MLRKEWNFHFITTYTLSLAATNSNPITHRELRNLNTRVCSNEVVKLHCSIPVLELALRHQIRRHRNGASPQCVVINNYSTWPQKLQHPFMVVCIVHFISIHKREVKTLFILPIFE*
Physicochemical properties
Number of amino acids:		115
Molecular weight:		12,200.249
Theoretical pI:		10.369
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		41480 41480
Instability index:		40.683
aromaticity		0.165
GRAVY		0.234
Secondary Structure Fraction
Helix		0.437
turn		0.214
sheet		0.262

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336128.1	complete	103	258-569(+)
Amino Acid sequence :
MTTHCGEAPLRWRRIWWRRASSNTGMLQWSLTTSLLQTLVFKFLNSLWVMGLLFVAASDNVYVVIKWKFHSFLNIQHSLIWELGRKFLSYLSFLFPPKVGHLE*
Physicochemical properties
Number of amino acids:		103
Molecular weight:		12,200.249
Theoretical pI:		10.369
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		41480 41480
Instability index:		40.683
aromaticity		0.165
GRAVY		0.234
Secondary Structure Fraction
Helix		0.437
turn		0.214
sheet		0.262