Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336129.1 | internal | 224 | 3-674(+) |
Amino Acid sequence : | |||
TLLGSSPRRKKQNPPPFPSYNGAPCRENQLRPRIQGERHVSGGLRPPRNRPRRGRDARPHVVPHRIRPLPAIQGRQDHRQPPHDHPDRRPHRNPNRARRRGPLVLLQHLLHAGPRRRRHR SRQRRRLRLEGGDSPGILVVHRACARLGPRRRTGSDRRRRRRCNAVDSRGGEGGGGVREEREAAGSELHRQRRISDRVDDYQRWIEGESNEVYEDEGEIGGRFR | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 13,598.417 | ||
Theoretical pI: | 6.457 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 56.983 | ||
aromaticity | 0.023 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.256 | ||
sheet | 0.310 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336129.1 | 3prime_partial | 203 | 64-672(+) |
Amino Acid sequence : | |||
MALLVEKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSAAVFAWKGETLQEYWWC TERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTIIRDGLKENPTKYTKMKERLVGVS | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 13,598.417 | ||
Theoretical pI: | 6.457 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 56.983 | ||
aromaticity | 0.023 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.256 | ||
sheet | 0.310 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336129.1 | 5prime_partial | 129 | 672-283(-) |
Amino Acid sequence : | |||
GNAHQSLLHLRILRWILLQSISDNRQHDLKFGVVGGARIRQLPALRVLLLRLHPLVNQQRCIAAVVDDQIRSAAGAPIERTLGAPPVFLESLPLPGEDGGAVASDDGGGVVLRGEDVAGA PADLGAERG* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 13,598.417 | ||
Theoretical pI: | 6.457 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 56.983 | ||
aromaticity | 0.023 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.256 | ||
sheet | 0.310 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336129.1 | internal | 224 | 3-674(+) |
Amino Acid sequence : | |||
TLLGSSPRRKKQNPPPFPSYNGAPCRENQLRPRIQGERHVSGGLRPPRNRPRRGRDARPHVVPHRIRPLPAIQGRQDHRQPPHDHPDRRPHRNPNRARRRGPLVLLQHLLHAGPRRRRHR SRQRRRLRLEGGDSPGILVVHRACARLGPRRRTGSDRRRRRRCNAVDSRGGEGGGGVREEREAAGSELHRQRRISDRVDDYQRWIEGESNEVYEDEGEIGGRFR | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 13,598.417 | ||
Theoretical pI: | 6.457 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 56.983 | ||
aromaticity | 0.023 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.256 | ||
sheet | 0.310 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336129.1 | 3prime_partial | 203 | 64-672(+) |
Amino Acid sequence : | |||
MALLVEKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSAAVFAWKGETLQEYWWC TERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTIIRDGLKENPTKYTKMKERLVGVS | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 13,598.417 | ||
Theoretical pI: | 6.457 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 56.983 | ||
aromaticity | 0.023 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.256 | ||
sheet | 0.310 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336129.1 | 5prime_partial | 129 | 672-283(-) |
Amino Acid sequence : | |||
GNAHQSLLHLRILRWILLQSISDNRQHDLKFGVVGGARIRQLPALRVLLLRLHPLVNQQRCIAAVVDDQIRSAAGAPIERTLGAPPVFLESLPLPGEDGGAVASDDGGGVVLRGEDVAGA PADLGAERG* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 13,598.417 | ||
Theoretical pI: | 6.457 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 56.983 | ||
aromaticity | 0.023 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.256 | ||
sheet | 0.310 |