| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336129.1 | internal | 224 | 3-674(+) |
Amino Acid sequence : | |||
| TLLGSSPRRKKQNPPPFPSYNGAPCRENQLRPRIQGERHVSGGLRPPRNRPRRGRDARPHVVPHRIRPLPAIQGRQDHRQPPHDHPDRRPHRNPNRARRRGPLVLLQHLLHAGPRRRRHR SRQRRRLRLEGGDSPGILVVHRACARLGPRRRTGSDRRRRRRCNAVDSRGGEGGGGVREEREAAGSELHRQRRISDRVDDYQRWIEGESNEVYEDEGEIGGRFR | |||
Physicochemical properties | |||
| Number of amino acids: | 224 | ||
| Molecular weight: | 13,598.417 | ||
| Theoretical pI: | 6.457 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 56.983 | ||
| aromaticity | 0.023 | ||
| GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.256 | ||
| sheet | 0.310 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336129.1 | 3prime_partial | 203 | 64-672(+) |
Amino Acid sequence : | |||
| MALLVEKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSAAVFAWKGETLQEYWWC TERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTIIRDGLKENPTKYTKMKERLVGVS | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 13,598.417 | ||
| Theoretical pI: | 6.457 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 56.983 | ||
| aromaticity | 0.023 | ||
| GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.256 | ||
| sheet | 0.310 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336129.1 | 5prime_partial | 129 | 672-283(-) |
Amino Acid sequence : | |||
| GNAHQSLLHLRILRWILLQSISDNRQHDLKFGVVGGARIRQLPALRVLLLRLHPLVNQQRCIAAVVDDQIRSAAGAPIERTLGAPPVFLESLPLPGEDGGAVASDDGGGVVLRGEDVAGA PADLGAERG* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 13,598.417 | ||
| Theoretical pI: | 6.457 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 56.983 | ||
| aromaticity | 0.023 | ||
| GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.256 | ||
| sheet | 0.310 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336129.1 | internal | 224 | 3-674(+) |
Amino Acid sequence : | |||
| TLLGSSPRRKKQNPPPFPSYNGAPCRENQLRPRIQGERHVSGGLRPPRNRPRRGRDARPHVVPHRIRPLPAIQGRQDHRQPPHDHPDRRPHRNPNRARRRGPLVLLQHLLHAGPRRRRHR SRQRRRLRLEGGDSPGILVVHRACARLGPRRRTGSDRRRRRRCNAVDSRGGEGGGGVREEREAAGSELHRQRRISDRVDDYQRWIEGESNEVYEDEGEIGGRFR | |||
Physicochemical properties | |||
| Number of amino acids: | 224 | ||
| Molecular weight: | 13,598.417 | ||
| Theoretical pI: | 6.457 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 56.983 | ||
| aromaticity | 0.023 | ||
| GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.256 | ||
| sheet | 0.310 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336129.1 | 3prime_partial | 203 | 64-672(+) |
Amino Acid sequence : | |||
| MALLVEKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSAAVFAWKGETLQEYWWC TERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTIIRDGLKENPTKYTKMKERLVGVS | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 13,598.417 | ||
| Theoretical pI: | 6.457 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 56.983 | ||
| aromaticity | 0.023 | ||
| GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.256 | ||
| sheet | 0.310 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336129.1 | 5prime_partial | 129 | 672-283(-) |
Amino Acid sequence : | |||
| GNAHQSLLHLRILRWILLQSISDNRQHDLKFGVVGGARIRQLPALRVLLLRLHPLVNQQRCIAAVVDDQIRSAAGAPIERTLGAPPVFLESLPLPGEDGGAVASDDGGGVVLRGEDVAGA PADLGAERG* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 13,598.417 | ||
| Theoretical pI: | 6.457 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 56.983 | ||
| aromaticity | 0.023 | ||
| GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.256 | ||
| sheet | 0.310 | ||