Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336134.1 | 5prime_partial | 204 | 2-616(+) |
Amino Acid sequence : | |||
GLXRDSGSGLGNGMNSYFSGDLSRYGISNGYELGNSGSGSLLSSTNRNMWENGYSNFGANSNGFVGSRTGNSGMDGSFGNIEEIWGSSPLSKSAEVGSIGSGNTVYGHGDNNFGGRAGYI GHNGGSAGSTSLYSTTNNVGEGSFDNMYGDSFNGDRAWRSSSLEHKNSASFGYGRGSAAADVTSETTAGYTGGYSVRSNRGIAA* | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 20,695.518 | ||
Theoretical pI: | 5.277 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32890 32890 | ||
Instability index: | 16.572 | ||
aromaticity | 0.108 | ||
GRAVY | -0.639 | ||
Secondary Structure Fraction | |||
Helix | 0.212 | ||
turn | 0.507 | ||
sheet | 0.163 |