| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336136.1 | internal | 253 | 3-761(+) |
Amino Acid sequence : | |||
| TLSRADSARGYEELALKVLCPSNKIGRVIGKGGSSIKSIRQETGARIEVDDPKGNHSDCVITVITSESPEDLKSMAVEAVLLLQGKINSDDDDTVTMRLLVPSKIIGCIIGKSGSIISEI RKRTRADIRISKGEKPKCADGNDELVEIFGQVSNVRDALIQIVLRLRVDVLKDRDDLRNSSTGVEPLYAGGASIPVSSVLHSVPSGASLSYDQRADSGSGLGLLSSGGYGYGSLSMGDNG YGSMSARSASLYS | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 17,509.330 | ||
| Theoretical pI: | 9.018 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 59.745 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.335 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.313 | ||
| sheet | 0.256 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336136.1 | 3prime_partial | 160 | 481-2(-) |
Amino Acid sequence : | |||
| MSASLTLLTCPKISTSSSFPSAHLGFSPFEIRISALVLLRISLIMEPLFPMIQPIIFDGTRSRMVTVSSSSLFIFPCNNKTASTAMDFKSSGDSEVITVMTQSLWFPLGSSTSIRAPVSC LMLLMELPPFPITRPILLEGHSTFKANSSYPRAESARDRV | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 17,509.330 | ||
| Theoretical pI: | 9.018 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 59.745 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.335 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.313 | ||
| sheet | 0.256 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336136.1 | internal | 253 | 3-761(+) |
Amino Acid sequence : | |||
| TLSRADSARGYEELALKVLCPSNKIGRVIGKGGSSIKSIRQETGARIEVDDPKGNHSDCVITVITSESPEDLKSMAVEAVLLLQGKINSDDDDTVTMRLLVPSKIIGCIIGKSGSIISEI RKRTRADIRISKGEKPKCADGNDELVEIFGQVSNVRDALIQIVLRLRVDVLKDRDDLRNSSTGVEPLYAGGASIPVSSVLHSVPSGASLSYDQRADSGSGLGLLSSGGYGYGSLSMGDNG YGSMSARSASLYS | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 17,509.330 | ||
| Theoretical pI: | 9.018 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 59.745 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.335 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.313 | ||
| sheet | 0.256 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336136.1 | 3prime_partial | 160 | 481-2(-) |
Amino Acid sequence : | |||
| MSASLTLLTCPKISTSSSFPSAHLGFSPFEIRISALVLLRISLIMEPLFPMIQPIIFDGTRSRMVTVSSSSLFIFPCNNKTASTAMDFKSSGDSEVITVMTQSLWFPLGSSTSIRAPVSC LMLLMELPPFPITRPILLEGHSTFKANSSYPRAESARDRV | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 17,509.330 | ||
| Theoretical pI: | 9.018 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 59.745 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.335 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.313 | ||
| sheet | 0.256 | ||