| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336148.1 | internal | 230 | 2-691(+) |
Amino Acid sequence : | |||
| ETVFPPMHHLTLSAPSTTASALCVAACELIGGHRSQAIAAASAIHLVHAAAHAHEHLPLTDGSRPECKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQ AAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGAACGAILAGGADEEIEKLRNFGLCAGTMRALMEVGNTPEIEKIVRRLKDLALKEMEGFHGDKAELMSN | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 10,635.122 | ||
| Theoretical pI: | 9.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33250 | ||
| Instability index: | 68.665 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.303 | ||
| sheet | 0.333 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336148.1 | 5prime_partial | 110 | 690-358(-) |
Amino Acid sequence : | |||
| FDISSALSPWKPSISLRAKSFNLLTIFSISGVFPTSINALIVPAQSPKFLSFSISSSAPPANMAPQAAPQPCISPYFFRHTYSTNPNLESGSTISASLYSPSISPCEPAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 10,635.122 | ||
| Theoretical pI: | 9.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33250 | ||
| Instability index: | 68.665 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.303 | ||
| sheet | 0.333 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336148.1 | 3prime_partial | 99 | 297-1(-) |
Amino Acid sequence : | |||
| MDRARSSNPNGAIPSPVRSSMLGLNLCWISGLHSGLEPSVRGRCSWAWAAACTRCMAEAAAMAWLRWPPMSSQAATQRAEAVVEGAERVRWCMGGNTVS | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,635.122 | ||
| Theoretical pI: | 9.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33250 | ||
| Instability index: | 68.665 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.303 | ||
| sheet | 0.333 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336148.1 | internal | 230 | 2-691(+) |
Amino Acid sequence : | |||
| ETVFPPMHHLTLSAPSTTASALCVAACELIGGHRSQAIAAASAIHLVHAAAHAHEHLPLTDGSRPECKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQ AAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGAACGAILAGGADEEIEKLRNFGLCAGTMRALMEVGNTPEIEKIVRRLKDLALKEMEGFHGDKAELMSN | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 10,635.122 | ||
| Theoretical pI: | 9.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33250 | ||
| Instability index: | 68.665 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.303 | ||
| sheet | 0.333 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336148.1 | 5prime_partial | 110 | 690-358(-) |
Amino Acid sequence : | |||
| FDISSALSPWKPSISLRAKSFNLLTIFSISGVFPTSINALIVPAQSPKFLSFSISSSAPPANMAPQAAPQPCISPYFFRHTYSTNPNLESGSTISASLYSPSISPCEPAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 10,635.122 | ||
| Theoretical pI: | 9.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33250 | ||
| Instability index: | 68.665 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.303 | ||
| sheet | 0.333 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336148.1 | 3prime_partial | 99 | 297-1(-) |
Amino Acid sequence : | |||
| MDRARSSNPNGAIPSPVRSSMLGLNLCWISGLHSGLEPSVRGRCSWAWAAACTRCMAEAAAMAWLRWPPMSSQAATQRAEAVVEGAERVRWCMGGNTVS | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,635.122 | ||
| Theoretical pI: | 9.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33250 | ||
| Instability index: | 68.665 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.303 | ||
| sheet | 0.333 | ||