Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336148.1 | internal | 230 | 2-691(+) |
Amino Acid sequence : | |||
ETVFPPMHHLTLSAPSTTASALCVAACELIGGHRSQAIAAASAIHLVHAAAHAHEHLPLTDGSRPECKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQ AAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGAACGAILAGGADEEIEKLRNFGLCAGTMRALMEVGNTPEIEKIVRRLKDLALKEMEGFHGDKAELMSN | |||
Physicochemical properties | |||
Number of amino acids: | 230 | ||
Molecular weight: | 10,635.122 | ||
Theoretical pI: | 9.173 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33250 | ||
Instability index: | 68.665 | ||
aromaticity | 0.061 | ||
GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.303 | ||
sheet | 0.333 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336148.1 | 5prime_partial | 110 | 690-358(-) |
Amino Acid sequence : | |||
FDISSALSPWKPSISLRAKSFNLLTIFSISGVFPTSINALIVPAQSPKFLSFSISSSAPPANMAPQAAPQPCISPYFFRHTYSTNPNLESGSTISASLYSPSISPCEPAA* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 10,635.122 | ||
Theoretical pI: | 9.173 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33250 | ||
Instability index: | 68.665 | ||
aromaticity | 0.061 | ||
GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.303 | ||
sheet | 0.333 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336148.1 | 3prime_partial | 99 | 297-1(-) |
Amino Acid sequence : | |||
MDRARSSNPNGAIPSPVRSSMLGLNLCWISGLHSGLEPSVRGRCSWAWAAACTRCMAEAAAMAWLRWPPMSSQAATQRAEAVVEGAERVRWCMGGNTVS | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,635.122 | ||
Theoretical pI: | 9.173 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33250 | ||
Instability index: | 68.665 | ||
aromaticity | 0.061 | ||
GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.303 | ||
sheet | 0.333 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336148.1 | internal | 230 | 2-691(+) |
Amino Acid sequence : | |||
ETVFPPMHHLTLSAPSTTASALCVAACELIGGHRSQAIAAASAIHLVHAAAHAHEHLPLTDGSRPECKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQ AAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGAACGAILAGGADEEIEKLRNFGLCAGTMRALMEVGNTPEIEKIVRRLKDLALKEMEGFHGDKAELMSN | |||
Physicochemical properties | |||
Number of amino acids: | 230 | ||
Molecular weight: | 10,635.122 | ||
Theoretical pI: | 9.173 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33250 | ||
Instability index: | 68.665 | ||
aromaticity | 0.061 | ||
GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.303 | ||
sheet | 0.333 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336148.1 | 5prime_partial | 110 | 690-358(-) |
Amino Acid sequence : | |||
FDISSALSPWKPSISLRAKSFNLLTIFSISGVFPTSINALIVPAQSPKFLSFSISSSAPPANMAPQAAPQPCISPYFFRHTYSTNPNLESGSTISASLYSPSISPCEPAA* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 10,635.122 | ||
Theoretical pI: | 9.173 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33250 | ||
Instability index: | 68.665 | ||
aromaticity | 0.061 | ||
GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.303 | ||
sheet | 0.333 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336148.1 | 3prime_partial | 99 | 297-1(-) |
Amino Acid sequence : | |||
MDRARSSNPNGAIPSPVRSSMLGLNLCWISGLHSGLEPSVRGRCSWAWAAACTRCMAEAAAMAWLRWPPMSSQAATQRAEAVVEGAERVRWCMGGNTVS | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,635.122 | ||
Theoretical pI: | 9.173 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33250 | ||
Instability index: | 68.665 | ||
aromaticity | 0.061 | ||
GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.303 | ||
sheet | 0.333 |