| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336168.1 | 5prime_partial | 164 | 1-495(+) |
Amino Acid sequence : | |||
| AAFMVDVGGGDGTAILSIVKGCPWIRGINFDLPHVASAAPPLHGIEHVGGDMFKEVPKADAVFIMWVLHDWGDEECIEILKKCKEAVPKETGKVIIAEAVIGEGEGDKYINGIRLALDMV MLAHTDTGKERTIEEWKYVLNGAGFSTYTVKDIDSIISIIEAHP* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 17,786.324 | ||
| Theoretical pI: | 4.874 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
| Instability index: | 20.454 | ||
| aromaticity | 0.073 | ||
| GRAVY | 0.126 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.201 | ||
| sheet | 0.262 | ||