| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336169.1 | 5prime_partial | 164 | 571-77(-) |
Amino Acid sequence : | |||
| HEGLVDVGGGDGTAIRSIVKGCPWIRGINFDLPHVAFAAPPLHGIEHVGGDMFKEVPKADAVFIMWVLHDWGDEECIEILKKCKEAVPKETGKVIIAEAVIGEGEGDKYINGIRLALDMV MLAHTDPGKERPIEEWKYVLNGAGFSSYTVKDIDFIMCIIEAHP* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 17,977.582 | ||
| Theoretical pI: | 4.988 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26720 | ||
| Instability index: | 24.108 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.041 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.207 | ||
| sheet | 0.256 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336169.1 | 5prime_partial | 164 | 571-77(-) |
Amino Acid sequence : | |||
| HEGLVDVGGGDGTAIRSIVKGCPWIRGINFDLPHVAFAAPPLHGIEHVGGDMFKEVPKADAVFIMWVLHDWGDEECIEILKKCKEAVPKETGKVIIAEAVIGEGEGDKYINGIRLALDMV MLAHTDPGKERPIEEWKYVLNGAGFSSYTVKDIDFIMCIIEAHP* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 17,977.582 | ||
| Theoretical pI: | 4.988 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26720 | ||
| Instability index: | 24.108 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.041 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.207 | ||
| sheet | 0.256 | ||