| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336178.1 | 5prime_partial | 207 | 3-626(+) |
Amino Acid sequence : | |||
| HPFRCRIGNEDSMEIPSPPPSPPKTVYKDPDDGRQRFFLELEFVQCLAKPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYLKFIMYPHCLFFLELLQNPNFRNAMAHPANKELAHRQQ FYFWKNYRNNRLKHILPKPLPESSTTATSASVAPLALPPTTVPAAVSNIPPAPPPQVPSPMQYGIGSGSTFVKNDPRNSGVEKRKRK* | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 23,966.199 | ||
| Theoretical pI: | 9.473 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
| Instability index: | 59.962 | ||
| aromaticity | 0.130 | ||
| GRAVY | -0.648 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.285 | ||
| sheet | 0.222 | ||