| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336187.1 | internal | 235 | 1-705(+) |
Amino Acid sequence : | |||
| AISTFLWPPPPCMATAVAVAGNQSYWDAIPDDINSYLKKAIPIRSPETVFEPMHHLTLSAPSTTASALCVAACELIGGHRSQAIAAASAIHLVHAAAHAHEHLPLTDGSRPECKPDIQHK FNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGAACGAILTGGADEEIEKLRNFGLCAGT | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 14,256.307 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 94.867 | ||
| aromaticity | 0.008 | ||
| GRAVY | -1.232 | ||
Secondary Structure Fraction | |||
| Helix | 0.161 | ||
| turn | 0.290 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336187.1 | 3prime_partial | 144 | 434-3(-) |
Amino Acid sequence : | |||
| MDRARSSNPNGAIPSPVRSSMLGLNLCWISGLHSGLEPSVRGRCSWAWAAACTRCMAEAAAMAWLRWPPMSSQAATQRAEAVVEGAERVRWCMGSNTVSGDLIGMAFLRYELMSSGMASQ YDWFPATATAVAMHGGGGQRKVDI | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 14,256.307 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 94.867 | ||
| aromaticity | 0.008 | ||
| GRAVY | -1.232 | ||
Secondary Structure Fraction | |||
| Helix | 0.161 | ||
| turn | 0.290 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336187.1 | 5prime_partial | 124 | 3-377(+) |
Amino Acid sequence : | |||
| DINLPLATAAVHGHRRRRRREPIILGRHPGRHQLVSQESHPNKIAGNGIRAHAPPHPLRPLHHRLRPLCGGLRAHRRPPEPSHRRRLRHTPRACGGPRPRAPPPNRRLQARMQARYPTQV QPQH* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 14,256.307 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 94.867 | ||
| aromaticity | 0.008 | ||
| GRAVY | -1.232 | ||
Secondary Structure Fraction | |||
| Helix | 0.161 | ||
| turn | 0.290 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336187.1 | internal | 235 | 1-705(+) |
Amino Acid sequence : | |||
| AISTFLWPPPPCMATAVAVAGNQSYWDAIPDDINSYLKKAIPIRSPETVFEPMHHLTLSAPSTTASALCVAACELIGGHRSQAIAAASAIHLVHAAAHAHEHLPLTDGSRPECKPDIQHK FNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGAACGAILTGGADEEIEKLRNFGLCAGT | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 14,256.307 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 94.867 | ||
| aromaticity | 0.008 | ||
| GRAVY | -1.232 | ||
Secondary Structure Fraction | |||
| Helix | 0.161 | ||
| turn | 0.290 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336187.1 | 3prime_partial | 144 | 434-3(-) |
Amino Acid sequence : | |||
| MDRARSSNPNGAIPSPVRSSMLGLNLCWISGLHSGLEPSVRGRCSWAWAAACTRCMAEAAAMAWLRWPPMSSQAATQRAEAVVEGAERVRWCMGSNTVSGDLIGMAFLRYELMSSGMASQ YDWFPATATAVAMHGGGGQRKVDI | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 14,256.307 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 94.867 | ||
| aromaticity | 0.008 | ||
| GRAVY | -1.232 | ||
Secondary Structure Fraction | |||
| Helix | 0.161 | ||
| turn | 0.290 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336187.1 | 5prime_partial | 124 | 3-377(+) |
Amino Acid sequence : | |||
| DINLPLATAAVHGHRRRRRREPIILGRHPGRHQLVSQESHPNKIAGNGIRAHAPPHPLRPLHHRLRPLCGGLRAHRRPPEPSHRRRLRHTPRACGGPRPRAPPPNRRLQARMQARYPTQV QPQH* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 14,256.307 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 94.867 | ||
| aromaticity | 0.008 | ||
| GRAVY | -1.232 | ||
Secondary Structure Fraction | |||
| Helix | 0.161 | ||
| turn | 0.290 | ||
| sheet | 0.210 | ||