Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336190.1 | 5prime_partial | 154 | 1-465(+) |
Amino Acid sequence : | |||
LDMKGGRSKAPSKKADAKLSVKKGAAAAKKPVAKKGKAAKDPNKPKRPASAFFVFMEDFRKTYKEKHPNNKSVSAVGKAGGEKWKSMSEAEKAPFVAKAEKRKAEYEKTLQAYNKKISDG AGADDESDKSKSEVNDDEDDDEEGSADDDDEDDE* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 16,746.309 | ||
Theoretical pI: | 7.932 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 35.492 | ||
aromaticity | 0.058 | ||
GRAVY | -1.347 | ||
Secondary Structure Fraction | |||
Helix | 0.130 | ||
turn | 0.227 | ||
sheet | 0.286 |