Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336193.1 | complete | 136 | 71-481(+) |
Amino Acid sequence : | |||
MAKSSWCLMVVVGVVIAHAASAARVTPADDKPNGLADQKNFLGFGGVGNYFGLGNNGIPYGGIGGATGTNGIPGLPGGVGVGGIIGTVPNGGIAGAGAGAGAGVGGGIPGGIGGFGGGAG GGGGAGIGAGTVPYNP* | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 12,584.501 | ||
Theoretical pI: | 4.797 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 55.902 | ||
aromaticity | 0.032 | ||
GRAVY | 0.824 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.214 | ||
sheet | 0.476 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336193.1 | complete | 126 | 123-503(+) |
Amino Acid sequence : | |||
MQLQLLGLRRPTTNQTASPTRRISSALAASGTTSASATMAFPTAASAAPPAPTESPAFLAASALAALSGLCLTAVLPVLVLVLELEWAAASLVALVDSAAAQVAEAELVSAPALCLITLE AFHISC* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 12,584.501 | ||
Theoretical pI: | 4.797 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 55.902 | ||
aromaticity | 0.032 | ||
GRAVY | 0.824 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.214 | ||
sheet | 0.476 |