Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336194.1 | 5prime_partial | 232 | 3-701(+) |
Amino Acid sequence : | |||
XPRGFGFLTLSDRRAMEDAIRDMHGRELGERVISVNKAQPKGGEDQGPGYGSYPVGGRGVYGGRDRLSGQDDCFKCGRPGHWARDCPSAGGGRGARVFSPPRSRYAGATTRGDRYADARD RYMDDIKDRGRFDDRDRYDIRDERYGSRDRYGSDRLPSGGDRFPLERFPAAADRYPLPAYGKDRAYERDFGPRGGSGGGVGPARYDGRSYRERPGPYDRPRRGGQPSFLDPY* | |||
Physicochemical properties | |||
Number of amino acids: | 232 | ||
Molecular weight: | 12,119.051 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39990 40115 | ||
Instability index: | 90.084 | ||
aromaticity | 0.108 | ||
GRAVY | -1.035 | ||
Secondary Structure Fraction | |||
Helix | 0.245 | ||
turn | 0.294 | ||
sheet | 0.176 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336194.1 | 5prime_partial | 103 | 2-313(+) |
Amino Acid sequence : | |||
AXSGIRLLDPFRPKGNGGCNPRYARSRTWRASHLCQQGPAKGRRRSRARLWKLSSRWKRGLRWKRQAFRTGRLLQMWPPRTLGPRLPVRWGWPRRSRILSSTF* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 12,119.051 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39990 40115 | ||
Instability index: | 90.084 | ||
aromaticity | 0.108 | ||
GRAVY | -1.035 | ||
Secondary Structure Fraction | |||
Helix | 0.245 | ||
turn | 0.294 | ||
sheet | 0.176 |