Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336197.1 | complete | 163 | 88-579(+) |
Amino Acid sequence : | |||
MGRMHAPGKGISQSALPYRRSIPNWLKLTPEDVKEHIFKLAKKGFTPSKIGVILRDSHGVSQVKLVFENNISRYLKVVSGNKILRIMRALGLAPSLPEDLYCLIKKAVSIRKHLERNRKD KDSKFRLILVESRIHRLARYYKLKRSLPPNWKYESSTASALVA* | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 18,688.893 | ||
Theoretical pI: | 10.551 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 52.571 | ||
aromaticity | 0.074 | ||
GRAVY | -0.370 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.239 | ||
sheet | 0.245 |