| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336205.1 | internal | 228 | 3-686(+) |
Amino Acid sequence : | |||
| IAIMSVAAAINVCVTGASGFIASWLVKFLLQKGYTVKASVRDPNDPKKTEHLLALDGAKERLCLMKANLLEEGSFDSIVDGCEGVFHTASPFYHAVKDPQAELIDPALKGTLNVLGSCAK TSTVKKIVLTSSIAAVAYCGKPRTPEVIVDETWWSDPEICKQMQLWYVLSKTLAEDAAWKFVKEKGIDMVAINPAMVIGPLLQPTLNTSAAAILNLINGAETYPNSSF | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 14,408.094 | ||
| Theoretical pI: | 5.003 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 39.546 | ||
| aromaticity | 0.125 | ||
| GRAVY | 0.374 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.294 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336205.1 | 5prime_partial | 136 | 688-278(-) |
Amino Acid sequence : | |||
| PNEEFGYVSAPFIKFNIAAALVFSVGCNNGPITIAGFMATMSIPFSFTNFQAASSASVFESTYQSCICLQISGSDHQVSSTITSGVRGLPQYATAAIDDVKTIFFTVDVLAHDPRTFRVP FNAGSINSACGSLTAW* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,408.094 | ||
| Theoretical pI: | 5.003 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 39.546 | ||
| aromaticity | 0.125 | ||
| GRAVY | 0.374 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.294 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336205.1 | internal | 228 | 3-686(+) |
Amino Acid sequence : | |||
| IAIMSVAAAINVCVTGASGFIASWLVKFLLQKGYTVKASVRDPNDPKKTEHLLALDGAKERLCLMKANLLEEGSFDSIVDGCEGVFHTASPFYHAVKDPQAELIDPALKGTLNVLGSCAK TSTVKKIVLTSSIAAVAYCGKPRTPEVIVDETWWSDPEICKQMQLWYVLSKTLAEDAAWKFVKEKGIDMVAINPAMVIGPLLQPTLNTSAAAILNLINGAETYPNSSF | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 14,408.094 | ||
| Theoretical pI: | 5.003 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 39.546 | ||
| aromaticity | 0.125 | ||
| GRAVY | 0.374 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.294 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336205.1 | 5prime_partial | 136 | 688-278(-) |
Amino Acid sequence : | |||
| PNEEFGYVSAPFIKFNIAAALVFSVGCNNGPITIAGFMATMSIPFSFTNFQAASSASVFESTYQSCICLQISGSDHQVSSTITSGVRGLPQYATAAIDDVKTIFFTVDVLAHDPRTFRVP FNAGSINSACGSLTAW* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,408.094 | ||
| Theoretical pI: | 5.003 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 39.546 | ||
| aromaticity | 0.125 | ||
| GRAVY | 0.374 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.294 | ||
| sheet | 0.191 | ||