| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336220.1 | 5prime_partial | 230 | 2-694(+) |
Amino Acid sequence : | |||
| ARRVHTKNKNMKTSIFILFSLFVTYANAATILVRNNCPYTVWAAGVPAGGGKRLDRGQTWTINAPPGTKQARVWGRTGCNFDASGKGKCQTGDCNGLLVCKSFGVPPNTLAEYALNQFAN KDFFDISLVDGFNVPMEFSPTSNGCTRGITCKAEINQQCPNELKAPGGCNNPCTVFKTDQYCCNSGNCGPTTFSRFFKERCPDAYSYPKDDQTSTFTCPAGTNYRVVFCP* | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 12,159.947 | ||
| Theoretical pI: | 11.655 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 66.606 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.318 | ||
| sheet | 0.200 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336220.1 | complete | 110 | 447-115(-) |
Amino Acid sequence : | |||
| MPRVHPLEVGLNSIGTLNPSTREISKKSLFANWFRAYSANVFGGTPKDLHTRRPLQSPVWHFPLPDASKLHPVRPQTRACLVPGGAFIVHVWPRSRRLPPPAGTPAAQTV* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,159.947 | ||
| Theoretical pI: | 11.655 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 66.606 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.318 | ||
| sheet | 0.200 | ||