Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336224.1 | complete | 100 | 3-305(+) |
Amino Acid sequence : | |||
MLQELGKQNPSLLRLIQENHQEFLQLINEPVDGSEGDIFDQGEQDMPHAVSVTPTEQEAIERMEAMGFERALVIEAFLACDRNEELAVNYLLEHAGDFED* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,358.466 | ||
Theoretical pI: | 4.105 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 64.473 | ||
aromaticity | 0.060 | ||
GRAVY | -0.438 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.180 | ||
sheet | 0.400 |