| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336224.1 | complete | 100 | 3-305(+) |
Amino Acid sequence : | |||
| MLQELGKQNPSLLRLIQENHQEFLQLINEPVDGSEGDIFDQGEQDMPHAVSVTPTEQEAIERMEAMGFERALVIEAFLACDRNEELAVNYLLEHAGDFED* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,358.466 | ||
| Theoretical pI: | 4.105 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 64.473 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.438 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.180 | ||
| sheet | 0.400 | ||