| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336250.1 | 3prime_partial | 244 | 3-734(+) |
Amino Acid sequence : | |||
| MANNTNAGVITCKAAVAWKPSEPLVVEEICVEPPKSTEVRIKMLAASMCHTDILLWKGFPLPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGECGECSNCATGKTNICFKYPPG IAGLMPDGTSRMSAKGQKLYHMFSCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFMTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASRILGASKIIGIDVNELKRDKARVFGVT EFIN | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 12,038.780 | ||
| Theoretical pI: | 9.299 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 47.952 | ||
| aromaticity | 0.097 | ||
| GRAVY | 0.351 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.310 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336250.1 | 3prime_partial | 113 | 340-2(-) |
Amino Acid sequence : | |||
| MFVFPVAQFEHSPHSPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGRGKPFQSRISVWHMLAASILILTSVDLGGSTQISSTTSGSDGFHATAALHVMTPAFVLFAM | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,038.780 | ||
| Theoretical pI: | 9.299 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 47.952 | ||
| aromaticity | 0.097 | ||
| GRAVY | 0.351 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.310 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336250.1 | 3prime_partial | 244 | 3-734(+) |
Amino Acid sequence : | |||
| MANNTNAGVITCKAAVAWKPSEPLVVEEICVEPPKSTEVRIKMLAASMCHTDILLWKGFPLPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGECGECSNCATGKTNICFKYPPG IAGLMPDGTSRMSAKGQKLYHMFSCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFMTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASRILGASKIIGIDVNELKRDKARVFGVT EFIN | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 12,038.780 | ||
| Theoretical pI: | 9.299 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 47.952 | ||
| aromaticity | 0.097 | ||
| GRAVY | 0.351 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.310 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336250.1 | 3prime_partial | 113 | 340-2(-) |
Amino Acid sequence : | |||
| MFVFPVAQFEHSPHSPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGRGKPFQSRISVWHMLAASILILTSVDLGGSTQISSTTSGSDGFHATAALHVMTPAFVLFAM | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,038.780 | ||
| Theoretical pI: | 9.299 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 47.952 | ||
| aromaticity | 0.097 | ||
| GRAVY | 0.351 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.310 | ||
| sheet | 0.212 | ||