| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336269.1 | complete | 189 | 2-571(+) |
Amino Acid sequence : | |||
| MKISTLISAMASSVMSSAAVATRGNGAQAPMVAPFTGLKSTASFPVSRKQNLDITSIASNGGRVSCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRE NNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVHEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEGY* | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 21,172.070 | ||
| Theoretical pI: | 7.620 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42650 | ||
| Instability index: | 33.504 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.254 | ||
| sheet | 0.254 | ||