Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336269.1 | complete | 189 | 2-571(+) |
Amino Acid sequence : | |||
MKISTLISAMASSVMSSAAVATRGNGAQAPMVAPFTGLKSTASFPVSRKQNLDITSIASNGGRVSCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRE NNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVHEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEGY* | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 21,172.070 | ||
Theoretical pI: | 7.620 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42650 | ||
Instability index: | 33.504 | ||
aromaticity | 0.116 | ||
GRAVY | -0.181 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.254 | ||
sheet | 0.254 |