| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336272.1 | internal | 260 | 2-781(+) |
Amino Acid sequence : | |||
| VSPKTLVAKSSSSASKVSPFPATLTTLASKSLSYKEVAVAAPGTVLKPLLEKVEELSEEKTDNQICISPKEATQQDGSEGVSLDDSLPDHGDAKGDDERDTQETGSESTHSASGIQETQS SHNQEKTVETNGSKLSAAAQPYSPSVFALTHSLQSTASISVYDALASQGTLTEPVGFPSVAAPVACGPRSSMYYGATQGFRVRPGVLNYQLPFNERNGVSPPKAMNPHAPEYVPKRAAWQ ANAATEDSKPTTDSELATDS | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 27,300.601 | ||
| Theoretical pI: | 4.919 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 55.719 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.556 | ||
Secondary Structure Fraction | |||
| Helix | 0.204 | ||
| turn | 0.312 | ||
| sheet | 0.262 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336272.1 | internal | 260 | 2-781(+) |
Amino Acid sequence : | |||
| VSPKTLVAKSSSSASKVSPFPATLTTLASKSLSYKEVAVAAPGTVLKPLLEKVEELSEEKTDNQICISPKEATQQDGSEGVSLDDSLPDHGDAKGDDERDTQETGSESTHSASGIQETQS SHNQEKTVETNGSKLSAAAQPYSPSVFALTHSLQSTASISVYDALASQGTLTEPVGFPSVAAPVACGPRSSMYYGATQGFRVRPGVLNYQLPFNERNGVSPPKAMNPHAPEYVPKRAAWQ ANAATEDSKPTTDSELATDS | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 27,300.601 | ||
| Theoretical pI: | 4.919 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 55.719 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.556 | ||
Secondary Structure Fraction | |||
| Helix | 0.204 | ||
| turn | 0.312 | ||
| sheet | 0.262 | ||