| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336276.1 | 5prime_partial | 206 | 3-623(+) |
Amino Acid sequence : | |||
| TRLGSGICAKRVVVPLRNHMLGRLASVLAKELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVYEGVPPPYDKV KKMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERSHAAYEKKKQLNKLRAKAEKIAVEKLGSQLDVIAPITY* | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 23,545.864 | ||
| Theoretical pI: | 10.511 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
| Instability index: | 46.288 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.395 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.184 | ||
| sheet | 0.277 | ||