| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336316.1 | 3prime_partial | 112 | 358-693(+) |
Amino Acid sequence : | |||
| MAAFYAGFPDTVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNPRVKTMAQAQNCLLPMGITSENVSHRFGVTRQEQDQAAVDSHRKAAAAT | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 11,801.214 | ||
| Theoretical pI: | 6.706 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 37.026 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.087 | ||
Secondary Structure Fraction | |||
| Helix | 0.223 | ||
| turn | 0.232 | ||
| sheet | 0.286 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336316.1 | 3prime_partial | 112 | 358-693(+) |
Amino Acid sequence : | |||
| MAAFYAGFPDTVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNPRVKTMAQAQNCLLPMGITSENVSHRFGVTRQEQDQAAVDSHRKAAAAT | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 11,801.214 | ||
| Theoretical pI: | 6.706 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 37.026 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.087 | ||
Secondary Structure Fraction | |||
| Helix | 0.223 | ||
| turn | 0.232 | ||
| sheet | 0.286 | ||