Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336320.1 | 3prime_partial | 162 | 170-655(+) |
Amino Acid sequence : | |||
MKATSFSYCLVDRDSNSSSTLDFNSTQPPDSVVAPLLLNNKSNFRYVGLSGISVGGEAVNFPASLLELGRDGRGGVIVDSGTTVSRLRREVYVPVRDAFRKMTANLSDGGAFLLFDTCYK LRSVAEARVPGVSFLFSGGGKLELRASNYMIPVDSETGIFCF | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 17,453.597 | ||
Theoretical pI: | 7.671 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 36.441 | ||
aromaticity | 0.099 | ||
GRAVY | 0.031 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.315 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336320.1 | 3prime_partial | 162 | 170-655(+) |
Amino Acid sequence : | |||
MKATSFSYCLVDRDSNSSSTLDFNSTQPPDSVVAPLLLNNKSNFRYVGLSGISVGGEAVNFPASLLELGRDGRGGVIVDSGTTVSRLRREVYVPVRDAFRKMTANLSDGGAFLLFDTCYK LRSVAEARVPGVSFLFSGGGKLELRASNYMIPVDSETGIFCF | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 17,453.597 | ||
Theoretical pI: | 7.671 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 36.441 | ||
aromaticity | 0.099 | ||
GRAVY | 0.031 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.315 | ||
sheet | 0.222 |