| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336339.1 | complete | 114 | 207-551(+) |
Amino Acid sequence : | |||
| MTKTILECITRGVVIGGVLVLGLGAAAMIYNLFKIRKMKNNKKIAEKIVEHNKKIAEKIVEHKMKIVEHFLQDPRVTKVQVGDSFVVERVLEKKGFNTGVTVAKHIEENHNDLI* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,874.196 | ||
| Theoretical pI: | 9.641 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 30.258 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.044 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.149 | ||
| sheet | 0.246 | ||