Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336339.1 | complete | 114 | 207-551(+) |
Amino Acid sequence : | |||
MTKTILECITRGVVIGGVLVLGLGAAAMIYNLFKIRKMKNNKKIAEKIVEHNKKIAEKIVEHKMKIVEHFLQDPRVTKVQVGDSFVVERVLEKKGFNTGVTVAKHIEENHNDLI* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,874.196 | ||
Theoretical pI: | 9.641 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 30.258 | ||
aromaticity | 0.044 | ||
GRAVY | -0.044 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.149 | ||
sheet | 0.246 |