Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336343.1 | 5prime_partial | 248 | 850-104(-) |
Amino Acid sequence : | |||
QTISLTSLACGLSFVLTGLIEAVALEYSGLKVEELSLDEKAEILFLDQGIATTVVLAVLYSLTKSFSPLPDDIYRYDWRDPFSLKKGWLLWAGIGLGGALAAIAGTGAVMSFFNGEPPQR ETDALMRLLPLIGSSSISTASLVGIVGILAPILEETVFRGFLMVSLTKWLPTPLAVLMSAAVFAGAHLTPGEFPQLFVLGTALGLCYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYD IKELLQAY* | |||
Physicochemical properties | |||
Number of amino acids: | 248 | ||
Molecular weight: | 12,376.296 | ||
Theoretical pI: | 10.710 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 49.669 | ||
aromaticity | 0.043 | ||
GRAVY | -0.238 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.330 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336343.1 | complete | 115 | 363-710(+) |
Amino Acid sequence : | |||
MRNPLKTVSSRMGASIPTIPTNEAVLILEDPISGSSRMRASVSLCGGSPLKKDITAPVPAMAAKAPPRPIPAHNNQPFLRLKGSLQSYRYMSSGRGENDFVRLYKTARTTVVAIP* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,376.296 | ||
Theoretical pI: | 10.710 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 49.669 | ||
aromaticity | 0.043 | ||
GRAVY | -0.238 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.330 | ||
sheet | 0.243 |