| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336344.1 | complete | 198 | 75-671(+) |
Amino Acid sequence : | |||
| MACLQCGRNVLRRTTMHHPLLFAAQGVRYRKLEVILTTTIDKLGKAGETVKVAPGHFRNHLMPKLLAVPNIDKFQYLIQEQRKIYQPKEVEMVKVVSNKDETNTKEYEAAANRLAKSRLN IRKFIIEGKGNELREPVTKEEILAEVARQLQVQLEPVNLHLPSPLLTTGEHKVPLRLPRSIPKPAGEDWILNIKIRKR* | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 22,717.460 | ||
| Theoretical pI: | 9.966 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 54.029 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.438 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.182 | ||
| sheet | 0.293 | ||