Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336361.1 | internal | 242 | 3-728(+) |
Amino Acid sequence : | |||
TGRIQKAFDDMVGLHKGAISNPDEGRMVGHYWLRNPKLAPKAILTQQIESTLERICQFADQVISGKIRPPGKDKFTQILSIGIGGSALGPQFVAEALAPDNPPLKIRFIDNTDPAGIDHQ IAQLGSELESTLVIVVSKSGGTPETRNGLLEVQKAFREAGLEFARQGVAITQENSLLDNTARIEGWLARFPMFDWVGGRTSEMSAVGLLAAALQGIDINEMLAGAALMDEANTTILVRYN PA | |||
Physicochemical properties | |||
Number of amino acids: | 242 | ||
Molecular weight: | 26,088.520 | ||
Theoretical pI: | 5.303 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 27.558 | ||
aromaticity | 0.058 | ||
GRAVY | -0.093 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.244 | ||
sheet | 0.293 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336361.1 | internal | 242 | 3-728(+) |
Amino Acid sequence : | |||
TGRIQKAFDDMVGLHKGAISNPDEGRMVGHYWLRNPKLAPKAILTQQIESTLERICQFADQVISGKIRPPGKDKFTQILSIGIGGSALGPQFVAEALAPDNPPLKIRFIDNTDPAGIDHQ IAQLGSELESTLVIVVSKSGGTPETRNGLLEVQKAFREAGLEFARQGVAITQENSLLDNTARIEGWLARFPMFDWVGGRTSEMSAVGLLAAALQGIDINEMLAGAALMDEANTTILVRYN PA | |||
Physicochemical properties | |||
Number of amino acids: | 242 | ||
Molecular weight: | 26,088.520 | ||
Theoretical pI: | 5.303 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 27.558 | ||
aromaticity | 0.058 | ||
GRAVY | -0.093 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.244 | ||
sheet | 0.293 |