| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336371.1 | internal | 239 | 2-718(+) |
Amino Acid sequence : | |||
| ESQVSHLHAMEVLQASSLSFPLLRRHSRNNLINKFRNPSLPRIDIPRQNIDLKTFAAITPTVAWPPSEPEIIPEKKEDKFEWYENWYPVATVCDLDKRRPHGKKVIGIDVVVWWDRKENA WKVFDDTCPHRLAPLSEGRIDQWGRLQCVYHGWCFDGAGACKFIPQAPHHGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIYLTKKPHYIPELDDPSFTCTMTTREVPYGYT | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 27,699.374 | ||
| Theoretical pI: | 8.571 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 68410 68910 | ||
| Instability index: | 46.617 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.572 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.238 | ||
| sheet | 0.172 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336371.1 | internal | 239 | 2-718(+) |
Amino Acid sequence : | |||
| ESQVSHLHAMEVLQASSLSFPLLRRHSRNNLINKFRNPSLPRIDIPRQNIDLKTFAAITPTVAWPPSEPEIIPEKKEDKFEWYENWYPVATVCDLDKRRPHGKKVIGIDVVVWWDRKENA WKVFDDTCPHRLAPLSEGRIDQWGRLQCVYHGWCFDGAGACKFIPQAPHHGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIYLTKKPHYIPELDDPSFTCTMTTREVPYGYT | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 27,699.374 | ||
| Theoretical pI: | 8.571 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 68410 68910 | ||
| Instability index: | 46.617 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.572 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.238 | ||
| sheet | 0.172 | ||