| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336372.1 | internal | 224 | 3-674(+) |
Amino Acid sequence : | |||
| HHHTLSYIVVFKSTMAATQDRKKLHIAMFPWLAFGHMIPYLDLSKFIAEKGHKISFISTPNNIDRLPKLPPNLASSVSFVKIPLPKLAELPENAEATTDLHRADQMDSLKRAFDGLESGV TGFLEESKPDWIIYDFTPHWLPPVTARLKIPGAFFFIVNAWFLSFYGPTRDLINGSDYRSKPEDFMVPPKWVDFDTKVAYRRFEAEWILRSVHNTGSGYSDIQR | |||
Physicochemical properties | |||
| Number of amino acids: | 224 | ||
| Molecular weight: | 13,076.802 | ||
| Theoretical pI: | 6.387 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 50.002 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.413 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.252 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336372.1 | 5prime_partial | 115 | 674-327(-) |
Amino Acid sequence : | |||
| TLNIRIPGTRIVNRPEYPLGFKPAICHFSVEVHPFRWDHEILRLGPIIRPVYQIAGRAIEREEPCIYDEKEGAGNLKAGRDRWQPMRSEIVDDPVGFGLFQETGHPGFEAVKGSL* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 13,076.802 | ||
| Theoretical pI: | 6.387 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 50.002 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.413 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.252 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336372.1 | internal | 224 | 3-674(+) |
Amino Acid sequence : | |||
| HHHTLSYIVVFKSTMAATQDRKKLHIAMFPWLAFGHMIPYLDLSKFIAEKGHKISFISTPNNIDRLPKLPPNLASSVSFVKIPLPKLAELPENAEATTDLHRADQMDSLKRAFDGLESGV TGFLEESKPDWIIYDFTPHWLPPVTARLKIPGAFFFIVNAWFLSFYGPTRDLINGSDYRSKPEDFMVPPKWVDFDTKVAYRRFEAEWILRSVHNTGSGYSDIQR | |||
Physicochemical properties | |||
| Number of amino acids: | 224 | ||
| Molecular weight: | 13,076.802 | ||
| Theoretical pI: | 6.387 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 50.002 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.413 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.252 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336372.1 | 5prime_partial | 115 | 674-327(-) |
Amino Acid sequence : | |||
| TLNIRIPGTRIVNRPEYPLGFKPAICHFSVEVHPFRWDHEILRLGPIIRPVYQIAGRAIEREEPCIYDEKEGAGNLKAGRDRWQPMRSEIVDDPVGFGLFQETGHPGFEAVKGSL* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 13,076.802 | ||
| Theoretical pI: | 6.387 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 50.002 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.413 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.252 | ||
| sheet | 0.217 | ||