| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336374.1 | 3prime_partial | 199 | 68-664(+) |
Amino Acid sequence : | |||
| MSKLQSEALREAISVIKNDSAEKKRKFSETIELQIGLKNYDPQKDKRFSGSVRLPHIPRPKMKICMLGDAQHVGEAEKIGLEYMDVESLKKLNKNKKLVKKLAKKYHAFLASESVIKQIP RLLGPGLNKAGKFPTLVSHQESLESKVNETKATIKFQMKKVLCMGVAVGNCDMEEKQIFQNVQMSVNFLISLPKKNWQN | |||
Physicochemical properties | |||
| Number of amino acids: | 199 | ||
| Molecular weight: | 14,844.373 | ||
| Theoretical pI: | 9.668 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 42.666 | ||
| aromaticity | 0.180 | ||
| GRAVY | 0.328 | ||
Secondary Structure Fraction | |||
| Helix | 0.383 | ||
| turn | 0.227 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336374.1 | 5prime_partial | 128 | 663-277(-) |
Amino Acid sequence : | |||
| FCQFFLGREIKKFTLICTFWKICFSSISQLPTATPMQSTFFIWNLMVALVSLTLDSRDSWWETRVGNLPALFRPGPKRRGICLMTDSEAKKAWYFFASFLTNFLFLLSFLRLSTSMYSKP IFSASPTC* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,844.373 | ||
| Theoretical pI: | 9.668 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 42.666 | ||
| aromaticity | 0.180 | ||
| GRAVY | 0.328 | ||
Secondary Structure Fraction | |||
| Helix | 0.383 | ||
| turn | 0.227 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336374.1 | 3prime_partial | 199 | 68-664(+) |
Amino Acid sequence : | |||
| MSKLQSEALREAISVIKNDSAEKKRKFSETIELQIGLKNYDPQKDKRFSGSVRLPHIPRPKMKICMLGDAQHVGEAEKIGLEYMDVESLKKLNKNKKLVKKLAKKYHAFLASESVIKQIP RLLGPGLNKAGKFPTLVSHQESLESKVNETKATIKFQMKKVLCMGVAVGNCDMEEKQIFQNVQMSVNFLISLPKKNWQN | |||
Physicochemical properties | |||
| Number of amino acids: | 199 | ||
| Molecular weight: | 14,844.373 | ||
| Theoretical pI: | 9.668 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 42.666 | ||
| aromaticity | 0.180 | ||
| GRAVY | 0.328 | ||
Secondary Structure Fraction | |||
| Helix | 0.383 | ||
| turn | 0.227 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336374.1 | 5prime_partial | 128 | 663-277(-) |
Amino Acid sequence : | |||
| FCQFFLGREIKKFTLICTFWKICFSSISQLPTATPMQSTFFIWNLMVALVSLTLDSRDSWWETRVGNLPALFRPGPKRRGICLMTDSEAKKAWYFFASFLTNFLFLLSFLRLSTSMYSKP IFSASPTC* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,844.373 | ||
| Theoretical pI: | 9.668 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 42.666 | ||
| aromaticity | 0.180 | ||
| GRAVY | 0.328 | ||
Secondary Structure Fraction | |||
| Helix | 0.383 | ||
| turn | 0.227 | ||
| sheet | 0.234 | ||