| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336375.1 | 5prime_partial | 193 | 773-192(-) |
Amino Acid sequence : | |||
| KRKFSETIELQIGLKNYDPQKDKRFSGSVRLPHIPRPKMKICMLGDAQHVGEAEKIGLESMDVESLKKLNKNKKLVKKLAKKYHAFLASESVIKQIPRLLGSGLNKAGKFPTLVSHQESL ESKVNETKATIKFQLKKVLCMGVAVGNCDMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLFLKSPMGKTQRVF* | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 16,104.792 | ||
| Theoretical pI: | 9.674 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29240 | ||
| Instability index: | 40.864 | ||
| aromaticity | 0.174 | ||
| GRAVY | 0.118 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.217 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336375.1 | complete | 138 | 217-633(+) |
Amino Acid sequence : | |||
| MGLFKNKHLTFCQFFFKRETKKFTLICTFWKICFSSISQLPTATPMQSTFFNWNLMVALVSLTLDSRDSWWETRVGNLPALFKPEPKRRGICLMTDSEAKKAWYFFASFLTNFLFLLSFL RLSTSMDSKPIFSASPTC* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 16,104.792 | ||
| Theoretical pI: | 9.674 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29240 | ||
| Instability index: | 40.864 | ||
| aromaticity | 0.174 | ||
| GRAVY | 0.118 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.217 | ||
| sheet | 0.239 | ||