| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336376.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
| HDVMSESHKNHKPVNVNVAPFNYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLRFSKDTNQQKFLPRQVADSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIQECEEKGIKGEEKVC ATSLESMVDFATSKIGNNVEAVSTEADSSERKVYRIEGVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAEWNPKHLAFQVLKVKPGTVPVCHYL PENHIVWVSK | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 13,910.350 | ||
| Theoretical pI: | 11.784 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 65.671 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.109 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.179 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336376.1 | 5prime_partial | 129 | 753-364(-) |
Amino Acid sequence : | |||
| SSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTPPCPYGTPPQPQPSTRRPPREKHRRPPSSQSCGSKTQHTHTPAGGTRPPACHSASSTLPRYGTLSSPNYPLLSTLLRRCSLFLMW RNQPWTPEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 13,910.350 | ||
| Theoretical pI: | 11.784 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 65.671 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.109 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.179 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336376.1 | 5prime_partial | 117 | 752-399(-) |
Amino Acid sequence : | |||
| LRNPHNVILREIMADWHSPWLHLQHLKSQMLRVPLRRVPMAHRHSLSLRPAGPHERNIVGHRRLSLVAVKHSILILLLVAHDHRLVTRLPRHSLDTVHFPLRTIRFCRHCFDVVPYF* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,910.350 | ||
| Theoretical pI: | 11.784 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 65.671 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.109 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.179 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336376.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
| HDVMSESHKNHKPVNVNVAPFNYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLRFSKDTNQQKFLPRQVADSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIQECEEKGIKGEEKVC ATSLESMVDFATSKIGNNVEAVSTEADSSERKVYRIEGVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAEWNPKHLAFQVLKVKPGTVPVCHYL PENHIVWVSK | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 13,910.350 | ||
| Theoretical pI: | 11.784 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 65.671 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.109 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.179 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336376.1 | 5prime_partial | 129 | 753-364(-) |
Amino Acid sequence : | |||
| SSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTPPCPYGTPPQPQPSTRRPPREKHRRPPSSQSCGSKTQHTHTPAGGTRPPACHSASSTLPRYGTLSSPNYPLLSTLLRRCSLFLMW RNQPWTPEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 13,910.350 | ||
| Theoretical pI: | 11.784 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 65.671 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.109 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.179 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336376.1 | 5prime_partial | 117 | 752-399(-) |
Amino Acid sequence : | |||
| LRNPHNVILREIMADWHSPWLHLQHLKSQMLRVPLRRVPMAHRHSLSLRPAGPHERNIVGHRRLSLVAVKHSILILLLVAHDHRLVTRLPRHSLDTVHFPLRTIRFCRHCFDVVPYF* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,910.350 | ||
| Theoretical pI: | 11.784 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 65.671 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.109 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.179 | ||
| sheet | 0.248 | ||