Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336376.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
HDVMSESHKNHKPVNVNVAPFNYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLRFSKDTNQQKFLPRQVADSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIQECEEKGIKGEEKVC ATSLESMVDFATSKIGNNVEAVSTEADSSERKVYRIEGVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAEWNPKHLAFQVLKVKPGTVPVCHYL PENHIVWVSK | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 13,910.350 | ||
Theoretical pI: | 11.784 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 65.671 | ||
aromaticity | 0.060 | ||
GRAVY | -0.109 | ||
Secondary Structure Fraction | |||
Helix | 0.368 | ||
turn | 0.179 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336376.1 | 5prime_partial | 129 | 753-364(-) |
Amino Acid sequence : | |||
SSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTPPCPYGTPPQPQPSTRRPPREKHRRPPSSQSCGSKTQHTHTPAGGTRPPACHSASSTLPRYGTLSSPNYPLLSTLLRRCSLFLMW RNQPWTPEK* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 13,910.350 | ||
Theoretical pI: | 11.784 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 65.671 | ||
aromaticity | 0.060 | ||
GRAVY | -0.109 | ||
Secondary Structure Fraction | |||
Helix | 0.368 | ||
turn | 0.179 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336376.1 | 5prime_partial | 117 | 752-399(-) |
Amino Acid sequence : | |||
LRNPHNVILREIMADWHSPWLHLQHLKSQMLRVPLRRVPMAHRHSLSLRPAGPHERNIVGHRRLSLVAVKHSILILLLVAHDHRLVTRLPRHSLDTVHFPLRTIRFCRHCFDVVPYF* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,910.350 | ||
Theoretical pI: | 11.784 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 65.671 | ||
aromaticity | 0.060 | ||
GRAVY | -0.109 | ||
Secondary Structure Fraction | |||
Helix | 0.368 | ||
turn | 0.179 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336376.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
HDVMSESHKNHKPVNVNVAPFNYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLRFSKDTNQQKFLPRQVADSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIQECEEKGIKGEEKVC ATSLESMVDFATSKIGNNVEAVSTEADSSERKVYRIEGVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAEWNPKHLAFQVLKVKPGTVPVCHYL PENHIVWVSK | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 13,910.350 | ||
Theoretical pI: | 11.784 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 65.671 | ||
aromaticity | 0.060 | ||
GRAVY | -0.109 | ||
Secondary Structure Fraction | |||
Helix | 0.368 | ||
turn | 0.179 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336376.1 | 5prime_partial | 129 | 753-364(-) |
Amino Acid sequence : | |||
SSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTPPCPYGTPPQPQPSTRRPPREKHRRPPSSQSCGSKTQHTHTPAGGTRPPACHSASSTLPRYGTLSSPNYPLLSTLLRRCSLFLMW RNQPWTPEK* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 13,910.350 | ||
Theoretical pI: | 11.784 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 65.671 | ||
aromaticity | 0.060 | ||
GRAVY | -0.109 | ||
Secondary Structure Fraction | |||
Helix | 0.368 | ||
turn | 0.179 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336376.1 | 5prime_partial | 117 | 752-399(-) |
Amino Acid sequence : | |||
LRNPHNVILREIMADWHSPWLHLQHLKSQMLRVPLRRVPMAHRHSLSLRPAGPHERNIVGHRRLSLVAVKHSILILLLVAHDHRLVTRLPRHSLDTVHFPLRTIRFCRHCFDVVPYF* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,910.350 | ||
Theoretical pI: | 11.784 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 65.671 | ||
aromaticity | 0.060 | ||
GRAVY | -0.109 | ||
Secondary Structure Fraction | |||
Helix | 0.368 | ||
turn | 0.179 | ||
sheet | 0.248 |