Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336377.1 | 5prime_partial | 154 | 763-299(-) |
Amino Acid sequence : | |||
AEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVLTEADSSERKVYRIEGVLRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVFFVGAGGLKAEAVAVCHRDTAEW NPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 12,342.460 | ||
Theoretical pI: | 11.163 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 59.801 | ||
aromaticity | 0.067 | ||
GRAVY | -0.054 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.171 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336377.1 | complete | 137 | 280-693(+) |
Amino Acid sequence : | |||
MLNYYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTPPCPYGTPPQPQPSTRRPPRKKHRRPPSSQSCGSKTQHTHTPAGGTRPPACHSASSTLPRYGTLSSPNYPLLSTLLR RCSLFLMWRNQPWTPEK* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 12,342.460 | ||
Theoretical pI: | 11.163 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 59.801 | ||
aromaticity | 0.067 | ||
GRAVY | -0.054 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.171 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336377.1 | complete | 105 | 341-658(+) |
Amino Acid sequence : | |||
MADWHSPWLHLQHLKSQMLRVPLRRVPMAHRHSLSLQPAGPHEKNIVGHRRLSLVAVKHSILILLLVAHDHRLVTRLPQHSLDTVHFPLRTIRFCQHCFDVVPYF* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 12,342.460 | ||
Theoretical pI: | 11.163 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 59.801 | ||
aromaticity | 0.067 | ||
GRAVY | -0.054 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.171 | ||
sheet | 0.248 |