Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336383.1	5prime_partial	146	525-85(-)
Amino Acid sequence :
VEAFPWVRGIAFDLPEVVADVPPRKGVDFVGGDMFETLPKADAVMLMWVLHDGSADKCIEILKKCKEAIPTSPGKVMIVDAIINEEGEGEEFLGARLSLDMTMMGMTTLGKERSSKEWVH LLNEAGFSKHPLKNIKTIEFVIEAYP*
Physicochemical properties
Number of amino acids:		146
Molecular weight:		13,579.196
Theoretical pI:		9.519
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18450
Instability index:		48.201
aromaticity		0.186
GRAVY		-0.288
Secondary Structure Fraction
Helix		0.389
turn		0.221
sheet		0.177

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336383.1	3prime_partial	135	122-526(+)
Amino Acid sequence :
MFLRGCLLNPASFSRCTHSLELLSFPSVVIPIIVISNDKRAPKNSSPSPSSLIIASTIITFPGLVGIASLHFFKISMHLSALPSCNTHMSMTASAFGRVSNMSPPTKSTPLRGGTSATTS GRSNAIPRTHGNAST
Physicochemical properties
Number of amino acids:		135
Molecular weight:		13,579.196
Theoretical pI:		9.519
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18450
Instability index:		48.201
aromaticity		0.186
GRAVY		-0.288
Secondary Structure Fraction
Helix		0.389
turn		0.221
sheet		0.177

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336383.1	5prime_partial	113	1-342(+)
Amino Acid sequence :
GIFHSYQTPDVGEEVDIENFLVLRVEWYSRISLNYKFYSFDVFERVFAKSSLIQQMHPFLGTSLLPQRRHPHHSHIQRQTSTQKLLAFSFFVNYSIHNHHFSGARWNRFFAFL*
Physicochemical properties
Number of amino acids:		113
Molecular weight:		13,579.196
Theoretical pI:		9.519
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18450
Instability index:		48.201
aromaticity		0.186
GRAVY		-0.288
Secondary Structure Fraction
Helix		0.389
turn		0.221
sheet		0.177

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336383.1	5prime_partial	146	525-85(-)
Amino Acid sequence :
VEAFPWVRGIAFDLPEVVADVPPRKGVDFVGGDMFETLPKADAVMLMWVLHDGSADKCIEILKKCKEAIPTSPGKVMIVDAIINEEGEGEEFLGARLSLDMTMMGMTTLGKERSSKEWVH LLNEAGFSKHPLKNIKTIEFVIEAYP*
Physicochemical properties
Number of amino acids:		146
Molecular weight:		13,579.196
Theoretical pI:		9.519
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18450
Instability index:		48.201
aromaticity		0.186
GRAVY		-0.288
Secondary Structure Fraction
Helix		0.389
turn		0.221
sheet		0.177

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336383.1	3prime_partial	135	122-526(+)
Amino Acid sequence :
MFLRGCLLNPASFSRCTHSLELLSFPSVVIPIIVISNDKRAPKNSSPSPSSLIIASTIITFPGLVGIASLHFFKISMHLSALPSCNTHMSMTASAFGRVSNMSPPTKSTPLRGGTSATTS GRSNAIPRTHGNAST
Physicochemical properties
Number of amino acids:		135
Molecular weight:		13,579.196
Theoretical pI:		9.519
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18450
Instability index:		48.201
aromaticity		0.186
GRAVY		-0.288
Secondary Structure Fraction
Helix		0.389
turn		0.221
sheet		0.177

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336383.1	5prime_partial	113	1-342(+)
Amino Acid sequence :
GIFHSYQTPDVGEEVDIENFLVLRVEWYSRISLNYKFYSFDVFERVFAKSSLIQQMHPFLGTSLLPQRRHPHHSHIQRQTSTQKLLAFSFFVNYSIHNHHFSGARWNRFFAFL*
Physicochemical properties
Number of amino acids:		113
Molecular weight:		13,579.196
Theoretical pI:		9.519
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18450
Instability index:		48.201
aromaticity		0.186
GRAVY		-0.288
Secondary Structure Fraction
Helix		0.389
turn		0.221
sheet		0.177