Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336384.1 | 5prime_partial | 142 | 2-430(+) |
Amino Acid sequence : | |||
GADSQGAQVYHGPKICKEKLENMLDEFSVPRCLFHNLGDCEEFAFNRATGFYWLKKKSKTERKIEKVGTVYYEKELSAFIQHRRLTKITGLKAKELFLTLTVSEILVGVPTDDKVKFVTS TGISRAIPITNLEPTMGESSGK* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 15,976.252 | ||
Theoretical pI: | 8.947 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 24.890 | ||
aromaticity | 0.092 | ||
GRAVY | -0.360 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.204 | ||
sheet | 0.246 |