| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336384.1 | 5prime_partial | 142 | 2-430(+) |
Amino Acid sequence : | |||
| GADSQGAQVYHGPKICKEKLENMLDEFSVPRCLFHNLGDCEEFAFNRATGFYWLKKKSKTERKIEKVGTVYYEKELSAFIQHRRLTKITGLKAKELFLTLTVSEILVGVPTDDKVKFVTS TGISRAIPITNLEPTMGESSGK* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,976.252 | ||
| Theoretical pI: | 8.947 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 24.890 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.360 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.204 | ||
| sheet | 0.246 | ||