Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336390.1 | complete | 146 | 127-567(+) |
Amino Acid sequence : | |||
MTLGSGGSIIVVPRNFRLLEELERGEKGIGDGTVSYGMDDGDDIYMRSWTGTIIGPHNSVHEGRIYQLKLFCDKDYPEKPPTVRFHSRINMTCVNHETGMVEPKKFSLLANWQQEYMMED ILTQLKKEMAAPHNRKLVQPPEGTYF* | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 16,706.924 | ||
Theoretical pI: | 5.943 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 30.847 | ||
aromaticity | 0.089 | ||
GRAVY | -0.559 | ||
Secondary Structure Fraction | |||
Helix | 0.281 | ||
turn | 0.247 | ||
sheet | 0.233 |