| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336426.1 | internal | 225 | 3-677(+) |
Amino Acid sequence : | |||
| QQSPDIAQGVPCHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKP VIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIIRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDS | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 17,979.704 | ||
| Theoretical pI: | 4.160 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 26.147 | ||
| aromaticity | 0.006 | ||
| GRAVY | -0.193 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.253 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336426.1 | 5prime_partial | 174 | 677-153(-) |
Amino Acid sequence : | |||
| GVDKHRQRLRHTDGVRDLHDAPPSEPVGNDALGRLPDDVGATPVDLGGVLPGEGPATVGAPPAVGVDDDLTAGETRIAVGPTDDETPGGVKVEDGLLVQVLLGDDWLDDVLLEIPRDLVV GDGLVVLGRDEDGVDPDGDHRTVLVVVLDGDLGLPVGSQPRARTVLADLRQTSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 17,979.704 | ||
| Theoretical pI: | 4.160 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 26.147 | ||
| aromaticity | 0.006 | ||
| GRAVY | -0.193 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.253 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336426.1 | internal | 225 | 3-677(+) |
Amino Acid sequence : | |||
| QQSPDIAQGVPCHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKP VIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIIRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDS | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 17,979.704 | ||
| Theoretical pI: | 4.160 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 26.147 | ||
| aromaticity | 0.006 | ||
| GRAVY | -0.193 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.253 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336426.1 | 5prime_partial | 174 | 677-153(-) |
Amino Acid sequence : | |||
| GVDKHRQRLRHTDGVRDLHDAPPSEPVGNDALGRLPDDVGATPVDLGGVLPGEGPATVGAPPAVGVDDDLTAGETRIAVGPTDDETPGGVKVEDGLLVQVLLGDDWLDDVLLEIPRDLVV GDGLVVLGRDEDGVDPDGDHRTVLVVVLDGDLGLPVGSQPRARTVLADLRQTSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 17,979.704 | ||
| Theoretical pI: | 4.160 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 26.147 | ||
| aromaticity | 0.006 | ||
| GRAVY | -0.193 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.253 | ||
| sheet | 0.236 | ||