| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336431.1 | 5prime_partial | 244 | 3-737(+) |
Amino Acid sequence : | |||
| SSPPPDEPHSPISRIYYIKADRIRAIQDEANAGNSPHNRRTKLEAFSAFLWKTIVSHKHPGGDNNSSLGIVVDGRSRLIEGDEEKMKLMAPYFGNVLSIPFGEKEIDELKEKALNWVANE VHEMLRAATTKEHFLGVIDWVEERRPKTMLAKIYSVGVGAVVVSSGQQFPVGKMDFGWGTPEFGSYHFPGGGKSGYVMPMPNAKGNGDWIVYMHLLKHQMDLIETNAFHVFNPLTSHYVF STTT* | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 14,028.373 | ||
| Theoretical pI: | 9.451 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 44.958 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.115 | ||
Secondary Structure Fraction | |||
| Helix | 0.382 | ||
| turn | 0.228 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336431.1 | complete | 144 | 558-124(-) |
Amino Acid sequence : | |||
| MIQIPASPTRNPSSPPETAAQMTPPPLLPPPSISSPASSSAAAPPPNLSPPENAPWSSPPATFHALHLLPNSMPSLSAHQSPSPQTGSTKHSRNRAPSASSSLRHPRSADSSRRLQSQGW NYYRRRDVCAKQWFSREMQKKPQA* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 14,028.373 | ||
| Theoretical pI: | 9.451 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 44.958 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.115 | ||
Secondary Structure Fraction | |||
| Helix | 0.382 | ||
| turn | 0.228 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336431.1 | complete | 123 | 401-30(-) |
Amino Acid sequence : | |||
| MLLGRRRPQHFMHFICYPIQCLLFQLINLLLPKRDRQNIPEIGRHQLHLLFVTLDQPTPPVDYNPKAGIIIAAGMFVRNNGFPEKCRKSLKLSSSIVWRVAGVGLVLDGSDAVSFDVIYT ADW* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 14,028.373 | ||
| Theoretical pI: | 9.451 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 44.958 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.115 | ||
Secondary Structure Fraction | |||
| Helix | 0.382 | ||
| turn | 0.228 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336431.1 | 5prime_partial | 244 | 3-737(+) |
Amino Acid sequence : | |||
| SSPPPDEPHSPISRIYYIKADRIRAIQDEANAGNSPHNRRTKLEAFSAFLWKTIVSHKHPGGDNNSSLGIVVDGRSRLIEGDEEKMKLMAPYFGNVLSIPFGEKEIDELKEKALNWVANE VHEMLRAATTKEHFLGVIDWVEERRPKTMLAKIYSVGVGAVVVSSGQQFPVGKMDFGWGTPEFGSYHFPGGGKSGYVMPMPNAKGNGDWIVYMHLLKHQMDLIETNAFHVFNPLTSHYVF STTT* | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 14,028.373 | ||
| Theoretical pI: | 9.451 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 44.958 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.115 | ||
Secondary Structure Fraction | |||
| Helix | 0.382 | ||
| turn | 0.228 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336431.1 | complete | 144 | 558-124(-) |
Amino Acid sequence : | |||
| MIQIPASPTRNPSSPPETAAQMTPPPLLPPPSISSPASSSAAAPPPNLSPPENAPWSSPPATFHALHLLPNSMPSLSAHQSPSPQTGSTKHSRNRAPSASSSLRHPRSADSSRRLQSQGW NYYRRRDVCAKQWFSREMQKKPQA* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 14,028.373 | ||
| Theoretical pI: | 9.451 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 44.958 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.115 | ||
Secondary Structure Fraction | |||
| Helix | 0.382 | ||
| turn | 0.228 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336431.1 | complete | 123 | 401-30(-) |
Amino Acid sequence : | |||
| MLLGRRRPQHFMHFICYPIQCLLFQLINLLLPKRDRQNIPEIGRHQLHLLFVTLDQPTPPVDYNPKAGIIIAAGMFVRNNGFPEKCRKSLKLSSSIVWRVAGVGLVLDGSDAVSFDVIYT ADW* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 14,028.373 | ||
| Theoretical pI: | 9.451 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 44.958 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.115 | ||
Secondary Structure Fraction | |||
| Helix | 0.382 | ||
| turn | 0.228 | ||
| sheet | 0.220 | ||