Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336445.1 | 5prime_partial | 132 | 776-378(-) |
Amino Acid sequence : | |||
IGRKIFNPKWKPYIPEFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELGYIEVKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDGPWQDCIE RFPVHIPEIVKL* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 12,514.369 | ||
Theoretical pI: | 8.218 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
Instability index: | 61.666 | ||
aromaticity | 0.088 | ||
GRAVY | 0.041 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.301 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336445.1 | complete | 113 | 400-741(+) |
Amino Acid sequence : | |||
MCTGNLSMQSCHGPSVGVLIVRLHFQTALLHLNPLPKAICQTLSPFFILPLTSMYPNSYQSDDDDVLPKRWSVIRDASTCSADSWRFFCSSSITARPPAWMQKCSNACLNSGM* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,514.369 | ||
Theoretical pI: | 8.218 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
Instability index: | 61.666 | ||
aromaticity | 0.088 | ||
GRAVY | 0.041 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.301 | ||
sheet | 0.212 |