| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336449.1 | 3prime_partial | 237 | 3-713(+) |
Amino Acid sequence : | |||
| MPNSARGRIGSMPRQATKLIATLSSRLLCPKQLHQHRNFGSPPPPPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPP PFAAKAILEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 25,098.895 | ||
| Theoretical pI: | 9.396 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 37.301 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.287 | ||
| sheet | 0.211 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336449.1 | 3prime_partial | 237 | 3-713(+) |
Amino Acid sequence : | |||
| MPNSARGRIGSMPRQATKLIATLSSRLLCPKQLHQHRNFGSPPPPPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPP PFAAKAILEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 25,098.895 | ||
| Theoretical pI: | 9.396 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 37.301 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.287 | ||
| sheet | 0.211 | ||