| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336468.1 | 5prime_partial | 243 | 876-145(-) |
Amino Acid sequence : | |||
| AKAVLRLVPVWCTCLAYAIVFAQAATLFTKQGATMDRTITPGFEIPAASMQSIIHICVVVLVPIYDRVLVPAARAVTKKPAGLTMLQRIGTGLFISVLLMVTAALVERKRLATAQEHGLV DDPEAVVPMSAWWLAPQYLLFGMADVFTVIGLQEFFYDQVPADLKSIGLALYLSVFGVGSFLSSFLISAIDEVTGGDGGGSWFSSNLNQGHIDYFYWLLAGISSVMLVAYYYFARSYVYK RKD* | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 11,470.554 | ||
| Theoretical pI: | 7.780 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
| Instability index: | 53.258 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
| Helix | 0.151 | ||
| turn | 0.330 | ||
| sheet | 0.132 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336468.1 | complete | 125 | 244-621(+) |
Amino Acid sequence : | |||
| MPLIQVARKPTPAAVAAGNLVDRGYQEATQKAPHTKNTEIQSKPNALKIRRNLIVEEFLQTDHGEHIRHTKQQILRRQPPRAHWDHGLWIVHEAVFLSCGQAFPLNKRCSHHEQYGDKQP CANPL* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 11,470.554 | ||
| Theoretical pI: | 7.780 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
| Instability index: | 53.258 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
| Helix | 0.151 | ||
| turn | 0.330 | ||
| sheet | 0.132 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336468.1 | 5prime_partial | 106 | 877-557(-) |
Amino Acid sequence : | |||
| CEGSPQTGPCLVHVSGLCNCFCTGRDAVHQTGSHNGPDHNARFRNPSRLHAVHHPHMCGGPRSHIRPGSGPSRQGCDQETGRPDNATEDWHRVVYLRIAHGDCSAC* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,470.554 | ||
| Theoretical pI: | 7.780 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
| Instability index: | 53.258 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
| Helix | 0.151 | ||
| turn | 0.330 | ||
| sheet | 0.132 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336468.1 | 5prime_partial | 243 | 876-145(-) |
Amino Acid sequence : | |||
| AKAVLRLVPVWCTCLAYAIVFAQAATLFTKQGATMDRTITPGFEIPAASMQSIIHICVVVLVPIYDRVLVPAARAVTKKPAGLTMLQRIGTGLFISVLLMVTAALVERKRLATAQEHGLV DDPEAVVPMSAWWLAPQYLLFGMADVFTVIGLQEFFYDQVPADLKSIGLALYLSVFGVGSFLSSFLISAIDEVTGGDGGGSWFSSNLNQGHIDYFYWLLAGISSVMLVAYYYFARSYVYK RKD* | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 11,470.554 | ||
| Theoretical pI: | 7.780 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
| Instability index: | 53.258 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
| Helix | 0.151 | ||
| turn | 0.330 | ||
| sheet | 0.132 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336468.1 | complete | 125 | 244-621(+) |
Amino Acid sequence : | |||
| MPLIQVARKPTPAAVAAGNLVDRGYQEATQKAPHTKNTEIQSKPNALKIRRNLIVEEFLQTDHGEHIRHTKQQILRRQPPRAHWDHGLWIVHEAVFLSCGQAFPLNKRCSHHEQYGDKQP CANPL* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 11,470.554 | ||
| Theoretical pI: | 7.780 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
| Instability index: | 53.258 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
| Helix | 0.151 | ||
| turn | 0.330 | ||
| sheet | 0.132 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336468.1 | 5prime_partial | 106 | 877-557(-) |
Amino Acid sequence : | |||
| CEGSPQTGPCLVHVSGLCNCFCTGRDAVHQTGSHNGPDHNARFRNPSRLHAVHHPHMCGGPRSHIRPGSGPSRQGCDQETGRPDNATEDWHRVVYLRIAHGDCSAC* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,470.554 | ||
| Theoretical pI: | 7.780 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
| Instability index: | 53.258 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
| Helix | 0.151 | ||
| turn | 0.330 | ||
| sheet | 0.132 | ||