Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336468.1 | 5prime_partial | 243 | 876-145(-) |
Amino Acid sequence : | |||
AKAVLRLVPVWCTCLAYAIVFAQAATLFTKQGATMDRTITPGFEIPAASMQSIIHICVVVLVPIYDRVLVPAARAVTKKPAGLTMLQRIGTGLFISVLLMVTAALVERKRLATAQEHGLV DDPEAVVPMSAWWLAPQYLLFGMADVFTVIGLQEFFYDQVPADLKSIGLALYLSVFGVGSFLSSFLISAIDEVTGGDGGGSWFSSNLNQGHIDYFYWLLAGISSVMLVAYYYFARSYVYK RKD* | |||
Physicochemical properties | |||
Number of amino acids: | 243 | ||
Molecular weight: | 11,470.554 | ||
Theoretical pI: | 7.780 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
Instability index: | 53.258 | ||
aromaticity | 0.038 | ||
GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
Helix | 0.151 | ||
turn | 0.330 | ||
sheet | 0.132 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336468.1 | complete | 125 | 244-621(+) |
Amino Acid sequence : | |||
MPLIQVARKPTPAAVAAGNLVDRGYQEATQKAPHTKNTEIQSKPNALKIRRNLIVEEFLQTDHGEHIRHTKQQILRRQPPRAHWDHGLWIVHEAVFLSCGQAFPLNKRCSHHEQYGDKQP CANPL* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 11,470.554 | ||
Theoretical pI: | 7.780 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
Instability index: | 53.258 | ||
aromaticity | 0.038 | ||
GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
Helix | 0.151 | ||
turn | 0.330 | ||
sheet | 0.132 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336468.1 | 5prime_partial | 106 | 877-557(-) |
Amino Acid sequence : | |||
CEGSPQTGPCLVHVSGLCNCFCTGRDAVHQTGSHNGPDHNARFRNPSRLHAVHHPHMCGGPRSHIRPGSGPSRQGCDQETGRPDNATEDWHRVVYLRIAHGDCSAC* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,470.554 | ||
Theoretical pI: | 7.780 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
Instability index: | 53.258 | ||
aromaticity | 0.038 | ||
GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
Helix | 0.151 | ||
turn | 0.330 | ||
sheet | 0.132 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336468.1 | 5prime_partial | 243 | 876-145(-) |
Amino Acid sequence : | |||
AKAVLRLVPVWCTCLAYAIVFAQAATLFTKQGATMDRTITPGFEIPAASMQSIIHICVVVLVPIYDRVLVPAARAVTKKPAGLTMLQRIGTGLFISVLLMVTAALVERKRLATAQEHGLV DDPEAVVPMSAWWLAPQYLLFGMADVFTVIGLQEFFYDQVPADLKSIGLALYLSVFGVGSFLSSFLISAIDEVTGGDGGGSWFSSNLNQGHIDYFYWLLAGISSVMLVAYYYFARSYVYK RKD* | |||
Physicochemical properties | |||
Number of amino acids: | 243 | ||
Molecular weight: | 11,470.554 | ||
Theoretical pI: | 7.780 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
Instability index: | 53.258 | ||
aromaticity | 0.038 | ||
GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
Helix | 0.151 | ||
turn | 0.330 | ||
sheet | 0.132 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336468.1 | complete | 125 | 244-621(+) |
Amino Acid sequence : | |||
MPLIQVARKPTPAAVAAGNLVDRGYQEATQKAPHTKNTEIQSKPNALKIRRNLIVEEFLQTDHGEHIRHTKQQILRRQPPRAHWDHGLWIVHEAVFLSCGQAFPLNKRCSHHEQYGDKQP CANPL* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 11,470.554 | ||
Theoretical pI: | 7.780 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
Instability index: | 53.258 | ||
aromaticity | 0.038 | ||
GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
Helix | 0.151 | ||
turn | 0.330 | ||
sheet | 0.132 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336468.1 | 5prime_partial | 106 | 877-557(-) |
Amino Acid sequence : | |||
CEGSPQTGPCLVHVSGLCNCFCTGRDAVHQTGSHNGPDHNARFRNPSRLHAVHHPHMCGGPRSHIRPGSGPSRQGCDQETGRPDNATEDWHRVVYLRIAHGDCSAC* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,470.554 | ||
Theoretical pI: | 7.780 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
Instability index: | 53.258 | ||
aromaticity | 0.038 | ||
GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
Helix | 0.151 | ||
turn | 0.330 | ||
sheet | 0.132 |