| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336474.1 | complete | 124 | 40-414(+) |
Amino Acid sequence : | |||
| MRWYYSLKRRLMLSIQLARGYPRFGMSVEKHKNGDYTSIIHGKYAHKKTVATASFAGNYIVVQNITEATYVCDYILCGGLDGSSSTKEAFLKKFKSAVSKGFDPDKHLQKVGIANQTTML KGET* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,907.910 | ||
| Theoretical pI: | 9.697 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
| Instability index: | 32.719 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.360 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.218 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336474.1 | complete | 124 | 40-414(+) |
Amino Acid sequence : | |||
| MRWYYSLKRRLMLSIQLARGYPRFGMSVEKHKNGDYTSIIHGKYAHKKTVATASFAGNYIVVQNITEATYVCDYILCGGLDGSSSTKEAFLKKFKSAVSKGFDPDKHLQKVGIANQTTML KGET* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,907.910 | ||
| Theoretical pI: | 9.697 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
| Instability index: | 32.719 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.360 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.218 | ||
| sheet | 0.210 | ||