| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336477.1 | 3prime_partial | 216 | 83-730(+) |
Amino Acid sequence : | |||
| MVMIIDQYIFGCFAASLLGFVLMYNLRRKMRRNRGSKHAGKDEYVKTSSAAAGGSRKETAGEADIIIVGAGVARATLAYTLGKDGRPVHVIERDLTEADRIVGELLQPGGYLKLIELGLE DCVSDIDAQRVFGYALYKDGKDAKLSYPLENFDSDISGRSFHNGRFIQRMREKAATLSNVRLEQGTVTSLVEEEGTVKGVQYKTKNGEEITAYAPL | |||
Physicochemical properties | |||
| Number of amino acids: | 216 | ||
| Molecular weight: | 18,486.211 | ||
| Theoretical pI: | 9.439 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 29.644 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.269 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336477.1 | 5prime_partial | 167 | 730-227(-) |
Amino Acid sequence : | |||
| KRSISCDLFTILGLILHTFNSSLFFNQRCHCALFKPYIGKGCCLFPHPLDETAIVEASTRDIRVEVLQGIRQLGIFTILVKGISKNSLSINITHTIFKAQLYQFQITSRLEKLANNAICF RQVSFNYMNWTAVLAKGISQRGPGNSGPDYDNVSLSSGLLPRATGGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 18,486.211 | ||
| Theoretical pI: | 9.439 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 29.644 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.269 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336477.1 | 3prime_partial | 216 | 83-730(+) |
Amino Acid sequence : | |||
| MVMIIDQYIFGCFAASLLGFVLMYNLRRKMRRNRGSKHAGKDEYVKTSSAAAGGSRKETAGEADIIIVGAGVARATLAYTLGKDGRPVHVIERDLTEADRIVGELLQPGGYLKLIELGLE DCVSDIDAQRVFGYALYKDGKDAKLSYPLENFDSDISGRSFHNGRFIQRMREKAATLSNVRLEQGTVTSLVEEEGTVKGVQYKTKNGEEITAYAPL | |||
Physicochemical properties | |||
| Number of amino acids: | 216 | ||
| Molecular weight: | 18,486.211 | ||
| Theoretical pI: | 9.439 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 29.644 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.269 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336477.1 | 5prime_partial | 167 | 730-227(-) |
Amino Acid sequence : | |||
| KRSISCDLFTILGLILHTFNSSLFFNQRCHCALFKPYIGKGCCLFPHPLDETAIVEASTRDIRVEVLQGIRQLGIFTILVKGISKNSLSINITHTIFKAQLYQFQITSRLEKLANNAICF RQVSFNYMNWTAVLAKGISQRGPGNSGPDYDNVSLSSGLLPRATGGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 18,486.211 | ||
| Theoretical pI: | 9.439 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 29.644 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.269 | ||
| sheet | 0.198 | ||