| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336481.1 | complete | 106 | 621-301(-) |
Amino Acid sequence : | |||
| MRDAFPHENRTPEVATITSYCCLHCGGLSPCCPSTGGSLPLLLRPADGFFVLLLFFSSSSSSSLLSSFFSSLSSSFFSLSSSISSSSSSASPYSSCAASPVNHDTA* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,117.674 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 36.479 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.955 | ||
Secondary Structure Fraction | |||
| Helix | 0.157 | ||
| turn | 0.206 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336481.1 | complete | 104 | 251-565(+) |
Amino Acid sequence : | |||
| MEQNYDIGSTIRDKIIPHAVSWFTGEAAQDEYGEADDDEEDIDEDNEKKDEDKDEKNEDNKDEDEDDEKKSKSTKKPSAGRKRRGREPPVDGQQGERPPQCKQQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 12,117.674 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 36.479 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.955 | ||
Secondary Structure Fraction | |||
| Helix | 0.157 | ||
| turn | 0.206 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336481.1 | complete | 102 | 264-572(+) |
Amino Acid sequence : | |||
| MILGRPSETKLFLMQYHGSLERLHRMSMGKPMMMKKILMKTMKKRMRTRMKKMKTTRTRMRMMKKKARAQKSRQQGARGGEENLLWMGNKVRGLHSASNSSW* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 12,117.674 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 36.479 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.955 | ||
Secondary Structure Fraction | |||
| Helix | 0.157 | ||
| turn | 0.206 | ||
| sheet | 0.324 | ||