Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336492.1 | complete | 237 | 792-79(-) |
Amino Acid sequence : | |||
MKDRDDEESKKLHLFRATLLNRDPSCKQDVDEATLRRFLRARDLDVEKASSMLIRWLNWRRTFVPNGSISESEVPNEIAQNKMFLQGKDKQGRPISVVYGSRHFSRKGGIDEFKRYLVFA LDKLCQSTPDGTGKFTIIGDLQGYGYCNSDIRAYLAAITILQDYYPERLGKMFVVHAPYIFNTMWKIIYPFIDKKTRDKVVFVEEKKLRETLLEEIDESQLPEIYGGKLQLVPIHNA* | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 13,213.494 | ||
Theoretical pI: | 9.614 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25355 | ||
Instability index: | 67.276 | ||
aromaticity | 0.079 | ||
GRAVY | 0.006 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.202 | ||
sheet | 0.219 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336492.1 | complete | 114 | 497-153(-) |
Amino Acid sequence : | |||
MALGIFQGKEASMNSSVIWCLLWISSVKVLQMEQESSQSSVIYKDMDIAIVISVHILQPLPFCRITTLKDWGKCSSFMRHTYLIQCGRSSTHSLTRKRETRLCLWRRRNCARLC* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 13,213.494 | ||
Theoretical pI: | 9.614 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25355 | ||
Instability index: | 67.276 | ||
aromaticity | 0.079 | ||
GRAVY | 0.006 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.202 | ||
sheet | 0.219 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336492.1 | complete | 237 | 792-79(-) |
Amino Acid sequence : | |||
MKDRDDEESKKLHLFRATLLNRDPSCKQDVDEATLRRFLRARDLDVEKASSMLIRWLNWRRTFVPNGSISESEVPNEIAQNKMFLQGKDKQGRPISVVYGSRHFSRKGGIDEFKRYLVFA LDKLCQSTPDGTGKFTIIGDLQGYGYCNSDIRAYLAAITILQDYYPERLGKMFVVHAPYIFNTMWKIIYPFIDKKTRDKVVFVEEKKLRETLLEEIDESQLPEIYGGKLQLVPIHNA* | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 13,213.494 | ||
Theoretical pI: | 9.614 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25355 | ||
Instability index: | 67.276 | ||
aromaticity | 0.079 | ||
GRAVY | 0.006 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.202 | ||
sheet | 0.219 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336492.1 | complete | 114 | 497-153(-) |
Amino Acid sequence : | |||
MALGIFQGKEASMNSSVIWCLLWISSVKVLQMEQESSQSSVIYKDMDIAIVISVHILQPLPFCRITTLKDWGKCSSFMRHTYLIQCGRSSTHSLTRKRETRLCLWRRRNCARLC* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 13,213.494 | ||
Theoretical pI: | 9.614 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25355 | ||
Instability index: | 67.276 | ||
aromaticity | 0.079 | ||
GRAVY | 0.006 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.202 | ||
sheet | 0.219 |